Identifiers and Description

Gene Model Identifier

SteCoe_1803

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006004800.000000000000001713908431542013protein phosphatase regulatory
subunit
Saccharomyces CerevisiaeYGL190C0.000000000000012664165549094176Non-essential regulatory subun
it B of protein phosphatase 2A
(PP2A); localization to cytop
lasm requires Zds1p and Zds2p
and promotes mitotic entry; lo
calization to nucleus prevents
mitotic exit; required for co
rrect nuclear division and chr
omosome segregation in meiosis
; maintains nucleolar sequestr
ation of Cdc14p during early m
eiosis; limits formation of PP
2A-Rts1p holocomplexes to ensu
re timely dissolution of siste
r chromosome cohesion; homolog
of mammalian B55
WormBaseWBGene000063520.0000000000002543665647376923
Oxytricha TrifallaxContig16838.0.g290.0000000000018795288165390832WD domain, G-beta repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1803(Protein)
MQDEEKLDTFYTSESKINSIKYSQSGSLLFFGDTNGNLYIKPKNSSQFSSFQCNFDSEID
VPMCYQPINKIEIAKSSDSRAIILTALDKSLESWKIFPQPQSNGCTKLVGKQENSVSGVH
ECTINSISMCQNMKNFLTSDDLNIFLWDLEKSDSVLHIVDHKETVQPISEVITGAKFHPH
NTYEIMWTSTNGSIRLGDMRTKLIMDKPGSVLKYESSKSWYYEELVVSISSAEFCKSHES
IVARDYFTVKYWDLRKTNSPYLIADVIEEQNLCMSELYQTQAICAEFEVKDCLGSEYGVT
GGYGEVFFIHRPTGEVFKQSFDTNQEILHIDTNDQGDITFAMNESLYTRSLTQDLLH


>SteCoe_1803(CDS)
ATGCAGGACGAAGAAAAACTTGACACTTTTTACACATCCGAAAGTAAAATCAACAGTATC
AAATACTCCCAATCAGGTTCACTACTGTTTTTTGGTGACACAAATGGCAACCTCTACATA
AAACCCAAAAATTCCTCACAATTCAGTTCATTCCAATGCAACTTTGACTCTGAAATTGAT
GTACCCATGTGTTATCAGCCTATAAACAAAATCGAAATCGCAAAATCCTCTGATTCTCGG
GCAATAATCCTCACAGCTCTAGACAAATCCTTGGAATCATGGAAAATTTTCCCTCAGCCT
CAAAGCAATGGGTGTACAAAACTGGTAGGTAAACAAGAAAACTCAGTCTCTGGAGTCCAC
GAATGCACAATAAACAGTATTTCAATGTGTCAAAACATGAAGAATTTCTTAACCTCAGAC
GATTTAAACATCTTTTTATGGGATTTAGAAAAATCTGACTCAGTTTTACATATAGTTGAC
CATAAAGAAACAGTTCAACCCATATCAGAAGTAATAACAGGAGCTAAATTCCACCCACAT
AACACATATGAAATCATGTGGACAAGTACAAATGGAAGTATTAGACTTGGGGATATGAGA
ACAAAACTTATTATGGATAAACCAGGTTCTGTTTTGAAATATGAGTCTAGTAAAAGTTGG
TATTATGAAGAGTTGGTTGTTAGTATATCAAGTGCTGAGTTTTGTAAATCTCATGAAAGC
ATTGTTGCTAGGGATTATTTTACAGTTAAATATTGGGATTTGAGGAAAACTAACAGTCCA
TATTTGATTGCTGATGTGATTGAAGAACAAAACCTTTGTATGAGTGAGCTTTATCAAACT
CAAGCTATATGTGCAGAGTTTGAAGTTAAGGACTGCTTAGGGTCGGAATATGGGGTTACT
GGGGGGTATGGAGAAGTGTTTTTTATACACAGGCCCACTGGAGAGGTATTTAAGCAGTCT
TTTGACACAAACCAGGAAATACTTCATATTGACACAAATGATCAAGGGGATATCACTTTT
GCTATGAATGAGTCTTTATATACACGGTCATTAACCCAAGATCTCTTACACTAA