Identifiers and Description

Gene Model Identifier

SteCoe_18170

Standard Name

None

Aliases

None

Description

Akt family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22319.0.g129.462629465836378e-57Protein kinase domain

Tetrahymena ThermophilaTTHERM_006378105.665668176358939e-52Protein kinase domain containi
ng protein. Sequence similarit
y to the AKT protein kinase fa
mily (Eisen et al., 2006)."
Saccharomyces CerevisiaeYKL126W2.7487850079102147e-43Serine/threonine protein kinas
e; phosphorylates and downregu
lates flippase activator Fpk1p
; inactivates Orm1p and Orm2p
(inhibitors of serine:palmitoy
l-coenzyme A transferase) by p
hosphorylation in response to
compromised sphingolipid synth
esis; mutations affect recepto
r-mediated endocytosis and sph
ingolipid-mediated and cell in
tegrity signaling pathways; ho
molog of mammalian kinase SGK;
YPK1 has a paralog, YPK2, tha
t arose from the whole genome
duplication
WormBaseWBGene000129295.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18170(Protein)
MGCCFNCLKSDDAEPSFKKPLTEDTNRSPMPQESPKALSPVDLNDFIIEKVLGKGAFGKV
FLVTKKDSGQVYAMKSLRKDMIEQRNQKIHTKTERQILGEVNSPFIVQLRFAFQTPEKLY
MVMDFINGGELFFHLRRCSKFAEDRTLFYAAEILEALEYLHMQGIIYRDLKPENVLLDSE
GHVKLTDFGLSKKFFSGEKKAYSFCGTPEYLAPEILKGIGHDHAVDFWSLGALIYEMLAG
APPFYSRNRDVMFRNMLSKPAEMKSHFSAQAVDLLRSLLQVDPKRRPISTAEIKKQPFFS
SIDWEKLKKRSIEAPFKPKLSGIKDLRYFDKIFTDEPTDDSVPPQTLNSVAKAANKYDDF
TYAEVQPQFKVD


>SteCoe_18170(CDS)
ATGGGTTGTTGTTTTAATTGTTTGAAGAGCGACGACGCTGAGCCATCCTTCAAAAAGCCG
CTAACCGAAGATACAAACAGATCTCCAATGCCTCAAGAAAGCCCTAAAGCGCTTTCCCCC
GTAGACCTAAATGATTTTATTATAGAAAAAGTTCTAGGAAAAGGTGCGTTCGGCAAAGTC
TTTTTAGTAACGAAAAAGGACTCAGGCCAAGTTTACGCAATGAAGTCCTTAAGAAAAGAT
ATGATTGAGCAAAGAAACCAAAAAATCCATACAAAAACCGAAAGGCAGATACTAGGCGAA
GTAAATTCCCCTTTCATCGTACAGCTACGGTTTGCATTCCAAACTCCTGAAAAACTTTAT
ATGGTTATGGACTTCATAAACGGTGGCGAGCTTTTTTTCCATCTGCGGCGTTGTTCCAAG
TTCGCCGAAGACCGGACTCTTTTCTATGCCGCTGAGATCCTTGAAGCTCTAGAATATCTT
CATATGCAAGGGATTATATACAGAGACTTAAAACCTGAAAATGTGCTTTTAGACAGCGAA
GGCCATGTAAAACTCACAGATTTCGGACTTAGTAAGAAGTTCTTCAGTGGAGAAAAAAAG
GCTTATTCCTTCTGTGGCACACCTGAGTATCTTGCTCCTGAAATTTTAAAAGGTATTGGT
CATGATCATGCTGTGGATTTCTGGTCATTGGGTGCTTTGATATATGAAATGCTTGCTGGT
GCACCACCTTTTTATTCAAGGAATAGAGATGTTATGTTTAGGAATATGCTCAGTAAGCCT
GCTGAAATGAAATCACACTTTTCAGCTCAGGCTGTTGATCTTTTACGTTCTTTATTACAA
GTTGATCCAAAACGTAGACCGATAAGTACAGCGGAGATTAAAAAGCAGCCTTTTTTCAGC
AGTATTGACTGGGAGAAATTAAAGAAAAGGTCAATCGAAGCACCGTTTAAACCGAAACTT
TCTGGGATTAAGGATTTGAGGTATTTTGATAAAATATTTACTGATGAACCTACTGATGAT
TCTGTGCCACCACAAACGCTTAATTCAGTGGCTAAAGCTGCGAATAAATATGATGATTTC
ACATATGCTGAAGTCCAGCCGCAGTTTAAAGTGGATTAA