Identifiers and Description

Gene Model Identifier

SteCoe_18176

Standard Name

None

Aliases

None

Description

CDPK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_011640907.868448159078602e-63Protein kinase domain containi
ng protein. Sequence similarit
y to the CDPK protein kinase f
amily (Eisen et al., 2006)."
Oxytricha TrifallaxContig10141.0.g452.572209372642415e-56Protein kinase domain

WormBaseWBGene000005535.380186160021138e-32
Saccharomyces CerevisiaeYOL016C3.221340285992516e-27Calmodulin-dependent protein k
inase; may play a role in stre
ss response, many CA++/calmodu
lan dependent phosphorylation
substrates demonstrated in vit
ro, amino acid sequence simila
r to mammalian Cam Kinase II;
CMK2 has a paralog, CMK1, that
arose from the whole genome d
uplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18176(Protein)
MEVPIKRQYLISSHGKDIKSHYTFDKSTLGQGSFGFVKPVIRLSDNCKRAVKVIPKSRVK
RPEVLQSEISIMKQIDHPSIIQLYETFEDDHYIYLIMEMCTGGELFDKIIEVEHFSEHKA
CEMFSQMLSAVAYLHSRGIVHRDLKPENYLFANRTDGAKLKLIDFGLAKVMTPQNNMSTK
SGTCYYIAPEILQGPYTEKCDLWSLGVILYMMLSGYPPFDGENEKEIIHAVRSGPLEFND
NVWNNVSRSAKDFITHLLDRNPTSRFSATDALSHPWITGYSELSQSSLTLDINKISSYQR
SVRFRRAVLNYMATQCSSEEIATLSELFCKIDTNKDGQLSLSELREALSAADISRPDLDQ
LINCIDADKNGTIDFTEFVAALMDRGMYMCQEKLWNAFKRFDIHDRGRITAQELQDVLDQ
ENIVKDSKYWANMVREVDINGDGTIDFEEFVKMMEQGPLSRFSSSEDRSPSNN


>SteCoe_18176(CDS)
ATGGAAGTACCAATAAAGAGGCAATATCTTATATCCTCCCACGGAAAAGATATCAAATCG
CACTACACCTTCGATAAGAGTACTCTTGGCCAAGGGTCTTTTGGCTTCGTAAAACCAGTC
ATAAGGCTTAGTGATAATTGCAAAAGAGCTGTCAAAGTCATTCCTAAATCCCGAGTAAAA
AGACCAGAAGTCTTACAGTCTGAGATTAGTATTATGAAGCAAATTGATCATCCTAGCATA
ATCCAACTTTACGAGACCTTTGAAGATGATCATTATATCTATTTGATCATGGAGATGTGC
ACAGGTGGAGAGCTTTTTGACAAAATTATCGAGGTCGAGCATTTTTCTGAGCATAAAGCA
TGTGAAATGTTCTCACAAATGCTCTCAGCTGTTGCTTATTTGCATAGTAGAGGCATTGTC
CATAGGGATTTGAAACCTGAGAACTATTTGTTTGCCAATAGAACAGATGGAGCTAAACTC
AAGCTCATAGACTTTGGTTTAGCTAAAGTTATGACTCCGCAGAACAATATGAGCACCAAA
TCAGGAACCTGCTACTATATCGCTCCAGAAATCCTTCAAGGACCCTACACTGAAAAATGT
GACCTATGGAGCTTAGGAGTCATTCTCTATATGATGCTCTCAGGTTATCCCCCTTTTGAT
GGTGAAAACGAAAAGGAAATTATCCATGCAGTACGTTCAGGTCCTTTAGAATTTAATGAT
AACGTATGGAACAATGTATCAAGGTCAGCCAAAGACTTCATAACGCATCTTTTAGACAGA
AATCCAACCTCGCGGTTCTCTGCAACTGATGCTCTATCCCATCCTTGGATAACTGGATAC
TCAGAACTAAGCCAATCTTCATTGACTTTAGACATAAACAAAATTTCTTCATATCAACGA
AGTGTTAGATTCCGTAGAGCTGTATTAAACTACATGGCCACACAATGCTCTTCTGAAGAA
ATCGCCACTTTATCTGAACTTTTCTGTAAAATTGATACTAACAAAGATGGCCAGCTTAGT
CTTTCTGAGCTCCGAGAAGCTTTGAGTGCTGCAGATATTTCAAGACCTGACTTAGACCAA
CTGATTAATTGTATAGACGCAGATAAAAATGGTACAATTGATTTCACTGAGTTTGTAGCC
GCGCTTATGGATCGTGGGATGTATATGTGCCAAGAGAAGCTTTGGAATGCTTTTAAGAGA
TTTGATATTCATGACAGAGGGAGGATTACAGCACAAGAGCTTCAAGACGTTCTTGACCAA
GAAAATATTGTTAAAGACTCGAAATACTGGGCCAATATGGTTAGAGAAGTGGATATAAAC
GGCGATGGGACAATTGACTTTGAAGAGTTTGTTAAAATGATGGAACAAGGACCATTGTCA
AGGTTTAGCAGTTCTGAGGACCGTAGTCCAAGCAATAATTAA