Identifiers and Description

Gene Model Identifier

SteCoe_18197

Standard Name

None

Aliases

None

Description

CRK7 kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17113.0.g225.0345753587649823e-45Protein kinase domain

Tetrahymena ThermophilaTTHERM_000116701.0112214926104486e-43Protein kinase domain containi
ng protein. Sequence similarit
y to the CRK7 subfamily of the
protein kinase CDK family (Ei
sen et al., 2006)."
WormBaseWBGene000071358.194012623990515e-40
Saccharomyces CerevisiaeYKL139W1.8048513878454153e-35Catalytic (alpha) subunit of C
-terminal domain kinase I (CTD
K-I); phosphorylates both RNA
pol II subunit Rpo21p to affec
t transcription and pre-mRNA 3
' end processing, and ribosoma
l protein Rps2p to increase tr
anslational fidelity; required
for H3K36 trimethylation but
not dimethylation by Set2p; si
milar to the Drosophila dCDK12
and human CDK12 and probably
CDK13

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18197(Protein)
MNFTSAWRCRPASNFEKLDQVGEGTYGNVFKARERITKVVFAMKKIKMDREKEGFPITAL
REIKLLKQMDHPNIIQLKEIITSKSPDERNPGNVYLLFEYMEHDLEGLLNMAKPRIEFTI
PHLKSYMKQMLQAIEYLHSKKIVHRDIKCANLLVNNQGQVKLGDFGLARTISGNPQETYT
NRVITLWYRPPELLLGANQYSFEVDMWSAGCIIGEILARQPMFPEGDEPKMLQKIYSICG
TFNEETWPESCNLPLYDKLGPKEKIERTIQTKYSDSSTYPNFDPLAIDLIDKLLQFNPKK
RLTATQALDHPYFHTQPLPCSESELPKVEIEMHEWMVKKQRKERQNREGQKVQPSQYPKP
PVKRPAEGPNISPSKKPRFDEDRE


>SteCoe_18197(CDS)
ATGAATTTCACATCAGCTTGGCGCTGTAGACCTGCAAGTAACTTTGAAAAACTAGATCAA
GTTGGTGAAGGGACATATGGAAACGTATTTAAAGCACGAGAGCGTATAACTAAGGTTGTC
TTCGCCATGAAAAAGATCAAAATGGATCGCGAGAAAGAAGGCTTCCCTATCACAGCTTTA
CGAGAAATCAAACTCCTAAAACAAATGGACCACCCAAATATAATCCAATTAAAAGAAATC
ATAACATCAAAATCCCCAGACGAACGTAACCCAGGCAACGTCTACCTTCTCTTTGAATAC
ATGGAACATGACTTAGAAGGTCTTTTAAACATGGCCAAGCCTCGTATTGAGTTTACAATT
CCTCATCTAAAATCTTATATGAAACAAATGCTTCAAGCAATCGAATATTTACATAGTAAA
AAAATAGTCCATCGTGACATAAAATGCGCTAATCTTCTAGTAAACAATCAAGGCCAAGTA
AAATTAGGAGATTTCGGTTTAGCTCGTACAATAAGTGGAAATCCTCAAGAAACATATACA
AATCGAGTTATAACATTATGGTATAGACCACCTGAATTATTACTAGGGGCGAACCAATAT
TCATTTGAAGTTGATATGTGGAGTGCTGGATGTATTATTGGGGAAATATTAGCTAGACAA
CCTATGTTCCCTGAAGGTGATGAGCCGAAAATGCTTCAGAAAATCTATTCAATATGTGGG
ACTTTTAATGAAGAAACCTGGCCGGAATCTTGTAACTTGCCTTTATATGACAAACTTGGT
CCTAAAGAAAAAATTGAGAGAACTATACAGACTAAATATAGTGATAGTTCTACATATCCA
AATTTCGATCCTTTGGCAATTGACCTTATAGATAAACTTTTACAATTCAACCCTAAAAAA
CGTTTAACAGCAACTCAAGCTCTTGATCACCCTTATTTCCATACCCAACCTTTACCATGT
AGTGAAAGTGAATTACCTAAAGTTGAGATCGAAATGCATGAATGGATGGTGAAAAAACAA
AGAAAAGAAAGGCAGAATCGAGAAGGGCAGAAAGTTCAACCAAGTCAATACCCGAAACCT
CCAGTCAAAAGACCTGCTGAAGGACCAAATATCAGCCCATCGAAAAAACCTCGTTTTGAT
GAAGATAGAGAATAA