Identifiers and Description

Gene Model Identifier

SteCoe_18286

Standard Name

None

Aliases

None

Description

TBPIP domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000225000
Tetrahymena ThermophilaTTHERM_011904400.0000000000018795288165390832Ubiquitously expressed paralog
of the meiotically expressed
gene HOP2 (TTHERM_00794620). E
ssential for vegetative growth
.
Tat binding protein 1(TBP-1)
-interacting protein (TBPIP)"
Oxytricha TrifallaxContig9892.0.g550.000000002061153622438558Tat binding protein 1(TBP-1)-i
nteracting protein (TBPIP)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18286(Protein)
MVRKKPKVDSQKPQETDENKEPVEPKEEKLAKGKKEKKIKTKEKPPTTQNNDTNTELNDD
NPQEEKREITEKKGKSHNNKKIVEENKESLSIEADPGENHGLKGDEAVVFEYMFHQNRPY
SLLNIFDNLRGAIKKPQMQKVLDKLVENGKFQSKEYGKVKIYLVNQQLIPEISQTELEEL
DHKIAELNEELETIRTEVKELQIQTKELENALSLEEIQKQLEDNKNNLQNLDDEIKIIQD
AGCVSEDMRKDIEGKLKIVMIEEKKRDKVWTGLLGGIAEMLDMPIKKAKEMIGVD


>SteCoe_18286(CDS)
ATGGTAAGAAAAAAGCCTAAAGTAGACTCACAAAAGCCACAAGAAACCGACGAAAATAAA
GAGCCTGTCGAGCCAAAAGAAGAAAAACTAGCAAAAGGCAAAAAGGAAAAAAAGATAAAA
ACAAAAGAAAAGCCACCAACAACACAAAACAATGATACAAATACTGAGCTTAACGATGAT
AATCCACAAGAAGAAAAAAGAGAAATCACTGAAAAAAAGGGAAAATCTCATAACAACAAG
AAAATAGTTGAAGAAAACAAAGAATCCTTATCAATCGAAGCTGATCCAGGAGAAAATCAT
GGACTTAAAGGTGATGAAGCTGTAGTTTTCGAATACATGTTTCATCAAAATCGTCCTTAC
AGTTTACTTAACATCTTCGACAATCTAAGGGGTGCAATTAAAAAACCTCAAATGCAAAAA
GTTCTTGACAAACTTGTTGAAAATGGTAAATTTCAATCAAAAGAATATGGTAAAGTTAAA
ATTTACCTTGTAAATCAACAATTAATACCAGAAATTAGCCAAACAGAACTTGAAGAATTA
GATCATAAGATAGCAGAATTAAATGAAGAATTAGAAACAATACGAACTGAAGTTAAGGAA
CTTCAAATTCAAACTAAAGAATTAGAAAATGCTTTGAGTTTAGAAGAAATACAGAAACAA
CTTGAAGATAATAAAAATAATTTGCAGAATTTAGATGATGAGATAAAAATTATACAAGAT
GCAGGATGTGTTTCTGAAGATATGAGAAAAGATATTGAAGGGAAATTGAAAATTGTAATG
ATTGAAGAAAAGAAAAGGGATAAAGTCTGGACTGGACTGCTTGGAGGAATTGCTGAAATG
CTTGATATGCCAATAAAAAAAGCGAAGGAAATGATAGGAGTTGATTAG