Identifiers and Description

Gene Model Identifier

SteCoe_18365

Standard Name

None

Aliases

None

Description

Pro_isomerase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000008793.3057006267607343e-37
Oxytricha TrifallaxContig22608.0.g342.4426007377405277e-36Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD

Saccharomyces CerevisiaeYDR155C1.3336148155022614e-34Cytoplasmic peptidyl-prolyl ci
s-trans isomerase (cyclophilin
); catalyzes the cis-trans iso
merization of peptide bonds N-
terminal to proline residues;
binds the drug cyclosporin A;
N-terminally propionylated in
vivo; protein abundance increa
ses in response to DNA replica
tion stress
Tetrahymena ThermophilaTTHERM_008770501.9792598779469045e-32peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18365(Protein)
MKYLLLFLLSFCVFSKVQDVQITSKVFFDVEADGEFLGRIIFGLYGKSVPRTSENFRALC
TGENGQTLDGKPLHYKGSTFHRVIPNFMVQGGDFTRGDGTGGESIYGKKFPDENFMLKHV
GPGILSMANSGQNTNGSQFFITTISTPWLDGKHVVFGEVVEGMDVVKKIEDLGSKSGKPS
KKIVIRDSGEI


>SteCoe_18365(CDS)
ATGAAATATTTGCTTTTATTCTTATTATCCTTTTGCGTTTTTTCTAAAGTCCAAGACGTC
CAAATTACAAGCAAAGTTTTTTTTGATGTTGAAGCTGATGGAGAATTTCTTGGTAGGATT
ATTTTTGGTTTATATGGAAAATCAGTCCCTAGGACTAGTGAGAATTTCAGAGCACTTTGC
ACAGGGGAAAATGGTCAGACTTTAGATGGTAAGCCTCTTCATTATAAAGGATCTACTTTT
CATAGAGTGATTCCTAATTTTATGGTTCAAGGTGGAGATTTTACACGTGGTGATGGTACA
GGAGGCGAAAGTATATATGGTAAGAAATTTCCTGATGAAAATTTTATGTTAAAACATGTA
GGTCCTGGGATACTTTCTATGGCGAATTCAGGTCAAAACACTAATGGGTCACAGTTTTTT
ATAACTACTATATCAACACCTTGGCTTGATGGCAAGCATGTTGTGTTTGGAGAAGTTGTT
GAAGGAATGGATGTCGTGAAGAAAATCGAAGATCTTGGGTCGAAAAGTGGAAAACCTTCA
AAGAAAATTGTAATAAGAGACTCAGGAGAAATCTAA