Identifiers and Description

Gene Model Identifier

SteCoe_18411

Standard Name

None

Aliases

None

Description

AAA_23 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYNL250W1.5628821893349888e-18Subunit of MRX complex with Mr
e11p and Xrs2p; complex is inv
olved in processing double-str
and DNA breaks in vegetative c
ells, initiation of meiotic DS
Bs, telomere maintenance, and
nonhomologous end joining; for
ms nuclear foci upon DNA repli
cation stress
Oxytricha TrifallaxContig17805.0.g21.5628821893349888e-18AAA domain

Tetrahymena ThermophilaTTHERM_007737904.248354255291589e-18Required for the formation and
repair of meiotic double-stra
nd breaks
WormBaseWBGene000042960.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18411(Protein)
MLQQLKISGMRSFSPNSEILIEFDEKLTLILGKNGAGKTTILECIKLACTGVFPPNSDNG
KWFIFDAKLLQKNEIHASVSVTLQSQTLSSIKITRSYLLQRKGEKAELRKVENLITRLND
QGKEYEKSLRIGEMDHIVNTAMGLNSAILQYVCFCHQDESLWPFSDSATLKKVFDQIFST
EEFSKAQTTLRKFLKAKRNQLTSKRNELVWSMKMLNEDRGNKDRLKVLWAEVTELKKVLE
GAKNEIIYVEGQYNSLKSVQSLWQSNEEKKKELKNVKDFLLSLEEYKDEIPEPAGSKDVV
DIIKEKNNLINELKVTEENLKKCEEEGQELYKIIAQVNAECNMINEKMQKSSEEFEKTLE
IVGNCKDIHKKALELNEEYEKVKSSRKNAKKEQQLFQNKHENALFTLDYSIKMSEKDLES
TQNSLNKLKSINLINNREELDYLTEEISRISNFIEESEKIVQSYKEKSPKIKKLLEKAQF
AEEITQENLENTYKSLKSLGISFDSSSNKLLNYSTKVFKLSKGSEGKTCIFYVKKYEFEN
KNPNILCQIQEIDEEIKSRTNDIREYKDKKLEYEQKRLEIANFIKNTEETLELMANKHGK
IEMELKENMVIKNNIIKDYEEYIENTEKSLALLKAHKNSLKVQKNTFQKLSGLISSLKSS
ENSLSESSTKLQTLKFRQSTLEKNQSSLSVLKTSHQKTLSSLESQLESIKNYQNTLKSHT
LYKQYKQQYQNLQSEILNSPAPCDFSPTKCENLNENITKLRIKCGKTEETLQHKKSEIQF
LEKKSPNSEEKAIQLYSEIEILEKCVKEQEILQKVLEKSIIAYHQQKIFQINEIIRQIWT
ETYKGDDIETIFISADPEKTDKRTSFSYKICFKSRNSEIDMRGRCSSGQRMMASLVVRIA
LAQAFSCGFSVIALDEPTTNMDSSNSEGLAECIAHLAEKHEKLQLIIISHDQDFLKKIIR
DSPRESYLTVNKFKNCSYIAKIKVS


>SteCoe_18411(CDS)
ATGTTACAACAACTAAAAATAAGCGGGATGCGGAGTTTCAGTCCAAACTCCGAGATTCTT
ATCGAGTTTGATGAAAAACTCACTCTTATCCTAGGGAAAAATGGTGCAGGGAAAACCACA
ATCCTCGAATGTATAAAGCTTGCTTGTACCGGAGTCTTCCCCCCAAATTCTGACAATGGC
AAATGGTTTATTTTCGACGCAAAACTTCTTCAAAAAAACGAAATCCACGCTTCAGTCTCA
GTAACCCTACAATCTCAAACCTTATCTTCAATAAAAATCACAAGATCCTACCTTCTTCAA
CGTAAAGGGGAAAAGGCGGAATTACGAAAAGTTGAAAATCTTATTACAAGACTTAATGAT
CAAGGCAAAGAATATGAAAAAAGTTTAAGAATTGGGGAAATGGATCATATTGTAAACACC
GCTATGGGGTTAAATTCAGCTATTCTTCAATATGTGTGTTTTTGTCATCAAGATGAAAGT
TTATGGCCTTTTTCTGATAGTGCGACATTGAAAAAGGTATTTGATCAGATATTTTCTACT
GAAGAGTTTAGTAAAGCTCAAACTACGTTAAGGAAATTTTTAAAAGCTAAACGTAATCAA
TTAACATCTAAGAGAAATGAACTTGTTTGGAGTATGAAGATGTTGAATGAAGATAGAGGG
AATAAAGATAGATTGAAAGTACTTTGGGCTGAGGTTACTGAGCTTAAGAAAGTTTTAGAA
GGGGCAAAGAATGAGATTATATATGTAGAAGGACAGTATAATTCTTTGAAGTCAGTGCAG
AGTTTGTGGCAGAGTAATGAGGAAAAGAAAAAAGAACTTAAAAATGTTAAGGATTTCTTA
TTGAGTTTGGAAGAGTATAAGGATGAAATTCCAGAACCTGCTGGCAGTAAAGATGTTGTT
GATATAATAAAAGAAAAAAATAATCTAATTAACGAGCTTAAAGTAACAGAAGAAAATCTG
AAAAAATGTGAAGAAGAAGGTCAGGAATTGTATAAAATTATCGCACAGGTTAATGCAGAA
TGTAATATGATTAATGAAAAAATGCAAAAATCTTCAGAGGAATTTGAAAAAACACTGGAA
ATCGTTGGTAACTGCAAAGATATACACAAAAAAGCATTAGAACTTAACGAGGAGTATGAA
AAAGTTAAATCCTCAAGAAAAAACGCTAAAAAAGAACAACAACTATTTCAAAATAAGCAC
GAAAATGCGCTTTTTACCTTAGATTACAGTATAAAAATGTCAGAAAAAGACCTTGAATCC
ACTCAAAATTCCTTAAACAAACTTAAGTCTATAAATCTCATTAATAATCGCGAAGAGCTC
GACTATTTAACAGAAGAAATTTCCCGCATAAGCAACTTCATCGAAGAATCCGAAAAAATA
GTCCAAAGTTATAAAGAAAAATCCCCAAAAATCAAAAAACTTCTTGAAAAAGCTCAATTT
GCAGAAGAAATCACCCAAGAAAACTTGGAAAATACCTACAAATCTTTAAAATCCTTAGGA
ATATCTTTTGACTCATCATCTAACAAATTATTAAACTATTCTACAAAAGTTTTCAAATTA
TCAAAAGGCTCTGAAGGGAAAACGTGTATTTTTTACGTTAAAAAGTATGAGTTTGAAAAC
AAAAACCCTAACATTTTATGTCAAATACAAGAAATTGATGAAGAAATAAAATCTAGGACT
AACGATATAAGAGAATACAAAGATAAAAAATTGGAATATGAACAAAAACGCTTGGAAATA
GCAAATTTTATAAAAAACACAGAAGAAACTCTGGAACTAATGGCAAATAAACACGGTAAA
ATTGAGATGGAACTTAAAGAAAATATGGTTATCAAGAACAACATTATAAAAGATTATGAA
GAATATATAGAAAATACAGAGAAATCTTTAGCCTTATTAAAAGCGCATAAAAATTCTCTA
AAAGTGCAAAAAAACACGTTCCAGAAACTGTCTGGCCTAATCAGTTCTTTAAAATCCTCA
GAAAATTCTTTATCTGAAAGTTCAACCAAACTTCAAACCCTGAAATTCCGCCAGTCAACT
CTTGAAAAAAATCAATCCTCACTGTCTGTCCTTAAAACTTCTCATCAAAAAACCCTTTCT
TCCTTAGAATCACAACTAGAATCCATTAAAAACTACCAAAATACCCTAAAAAGCCATACC
CTCTACAAACAATACAAACAACAATATCAAAACCTCCAAAGTGAAATCCTAAATTCCCCA
GCTCCCTGCGATTTTTCCCCAACCAAATGCGAAAATCTCAATGAAAACATCACAAAACTC
CGAATTAAATGTGGGAAAACCGAAGAAACCCTTCAACACAAGAAATCCGAAATCCAATTC
TTAGAAAAAAAATCTCCGAACTCAGAAGAAAAAGCTATCCAATTGTATTCTGAAATAGAA
ATACTAGAAAAATGTGTCAAAGAGCAAGAAATACTACAAAAAGTTCTTGAAAAGTCGATA
ATCGCATATCATCAGCAAAAGATTTTCCAAATCAATGAAATCATAAGGCAAATATGGACT
GAAACTTATAAAGGTGATGATATCGAGACAATTTTCATATCGGCCGACCCTGAAAAAACC
GATAAAAGGACGAGTTTTAGTTATAAAATATGCTTCAAAAGCCGTAATAGTGAAATTGAT
ATGCGTGGCAGATGCTCATCAGGCCAAAGAATGATGGCAAGTCTTGTTGTCAGAATCGCT
TTAGCCCAAGCTTTTTCATGTGGTTTCTCAGTTATAGCTTTAGATGAACCAACTACAAAT
ATGGACTCATCTAATTCTGAAGGTCTTGCAGAATGCATTGCCCATTTAGCTGAAAAACAT
GAAAAGCTTCAGCTGATTATCATCTCACACGACCAGGATTTCTTGAAAAAAATCATAAGA
GACTCACCAAGGGAAAGCTATCTAACTGTAAACAAGTTCAAAAACTGTTCTTATATCGCA
AAAATAAAAGTTAGTTAA