Identifiers and Description

Gene Model Identifier

SteCoe_18549

Standard Name

None

Aliases

None

Description

DHC_N2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14020.0.g490Dynein heavy chain and region
D6 of dynein motor

WormBaseWBGene000004850

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18549(Protein)
MDERLPHASEKQPRSRLARLAGRESDLASTAVLSLNPGLNYSKNHFKGLYKADLKKELEE
WDLPFASARNRPTGAILTNTKLPPITYEESNEEDDQTTPGNREFDFHTLTKMLNDSSKPR
SGLASGAQETLFVDRESMIFKELKKIITGEDAISFFAKNGNTTPVKFLYCNKASANSKIF
RPYDLVVVPEKEIHPEYFTISAQGVVHVMPKTSEGSVTTFYSLADWMHQSKLFNLLTSMK
FFKHYLNGKVFSLWRGNVRYNHYCATRNRLKRNLFHAKPVFIESLPKINELLYTMTTCHL
LDIPDKSNDLSSYVETQKQQRTQAKKDFDVTMEKLGNECESVKQTVHESAQLPEMEDMDP
AKLGQRNKKKSMVQQKLEEKERKHKLQLAEEHKSMLGNYIRLVDYMSSETIVILILDRTK
KFYKNLTERRSNKIFTTKVIYGKDCIVFDPNEEEFLEKLEGILEGILSEIGNLSRLTYRF
DDILATDRLSPLQMADIIKSSESYQNTRKRIREKFHDDFVEAQAYVETYFEKARYVNDYV
ETWNFEIYRAEGHTVQQIKDELNKIKETMTKDVSMYVHSGPNNTVKGILNIDGKAIKNHL
HQSLTSAQNDLKSYLNSMASSKADQSNQELSEMNLKLSQQPSPLSDFIKYMEDLTTSKAA
IQTIESSRAELEEIEKTLRREKFSDSPGTNPKFIQLDSNIKICKTNIDQANDFIEKKKPD
MEKKLASRVEKLKVTLSEDLSKKLDEGSIILVEAHPTEALNELKKIETRLKKCENNAEKF
KHFQEVFAVGVTRIKELEDTSFKFKSKNKLWNLRKEWDEFHGKLMNDDFLSLGPDLKKSI
SRFEKESGNLKRELMMYSKEGKDLVAEDFYTRVKEVSAYLPIIECLGIEALKTRHWIKIH
NALPKEKEYTEGGFFSLSELIDHGVMQIRDKVEEISATAAGEFSLENTVEEIRQAWSTTN
FELSNYREQKDKFYITKVEDTLTQLEDHQVSVQTMLGNRHVAEIKGMIEDWDKKLRLVQD
VIDEWLICQKQWMYLENIFSAPDIQKQLPRETTKFQGVDRFWRELMLRTNKNPAVIEACI
SEGLLDKFKRNNKILEEIKKSLDEYLESKRLAFPRFYFLADEELLEILSQTRNPRKVQDH
LRKCFDNMDKIIFKEEKEGLTVTGMISGEHETVNYSQVVVPEGNVEHWLTKIEEMMKLSL
YDLTKKAIQVYPKDELNRRAWFFEYNIPAQCLLVVDQIKWTFWATEAIDNVEHERNKGAI
KEFWEFLRLQIKDSVGIVRGELTGLQRTLMGALITLDVHGRDVIDSLVQKDVKSLWDFEW
SKQLRYYWESDIDDCRVRQTNAKFRYSYEYLGNGPRLVITPLTDKCYLTLTGALHLYYGG
APAGPAGTGKTETTKDLGKALAIQCVVFNCSDGLDVNIMARFFSGLAQAGAWSCFDEFNR
IDIEVLSVIAQQILTIQHAVRNNQEEFEFFGRNIKLDKRFGVFITMNPGYAGRTELPDNL
KALFRPVAMMIPDYAMIAEIMLFSEGFEKARVLARKMVQLYKLASEQLSKQDHYDFGMRA
VKSVLVMAGQLRRKNPQLSEDVILIRAMRDSNVPKFLEQDLPLFRGIITDLFPEVVVPFV
DYGNLERSIREQLLKKGLQALDAFVLKIIQLFETMLVRHGNMIVGPAATGKTNLYKTLAD
ALAQLHDEEEADETKKKDPDHQKILYYPLNPKAISMGELYGQTSLTGDFTDGIVPILVRS
AKSDNTPAKKWIVFDGPVDSLWIESMNTVLDDNKMLCLTSGERIKLPDTITMLFEVQDLA
QASPATVSRCGMVYLDPVHLGWLPLIDSWHDKFKIQLPTYADHVVEQTKKFISTLLPFVK
HDCKEEIQSSSTNLVTSCLNLITSLVKQELIAKKRPDDAENLINVYLIFALTWSLGANLN
DVSRLLFDKKMRVEIESLYRHFPYSNTVFDYCIDDDMCEFVPWESRVPSFNYNSKQPFFM
ILVPTVDTVRDRFILEVLAKKSHHLLFSGNTGVGKTVIIKDYLNAGNNDWFVSTVINCSA
QTSTQNINDVFEDKLEAPRKKIRRPPPGKKMIMFIDDVNMPALDLFGSQPPIELLRQIIE
AGFYDLKNYFFKNVEDVIFVAACAPPGGGRNQVSPRFFRHFNMIWQIQLAQSSMEAIFSS
ILRGFLDEHPDENLSDHADPIVKTSVENYIKICNDLLPTPSKSHYTFNLRDLSKVVQGML
MISYENLRNVDTLLLLWLHECCRVFRDRLVDDKDRNWFNEELERKMRMNLNVDIPSREKW
ADIIFGDFMSGPYKEYVKIEYGNKLFDRLALALEQYNSEFSSRMNLVFFKDAINHLTRIC
RILRQPRGNALLVGVGGSGRQSLARLAVSMAGYRPFSIEITRIYGVVQFREDLKVLLKSA
GAQNEQIAFIFSDTQIVKESFLEDINNVLNTGEVPNLYEIQDTEEIIGLVRQSAKEAGRP
DTKDAIFQHYVQLCRDNLHIVLAFSPVGEQFRVRCRQFPSIVNCCTLDWYSAWPRDALFS
VAQRFFNENEHLGIKDLKDQLCNICVEIHSSVTKKSKDFELELRRKNYTTPTSYLELIKL
YLDMLTLQQKKVPEQINKYVTGLKRLKETNEMVSDMQKEQAELKIILKKSSEENARMQIE
LQGKQADAKVKEEACAKDEADCSVTMKEVSEIKDECQKDLDEALPALNAANRALGNLNKS
DIVEIKSYPKPPPGVEMVMNAVCLLFKEKQTWDSGKKLLGDMNFLQNCMNFPKDDISNQT
LRKLQTYMANPEFNKDSVAKVSIAAGSLCEWAMAMDKYARISRNIEPKRNRLAQAETNLK
VAQEQLNEKQTTLRAIQKEVSELEATFQASVKKGEELRKKSELTEARLDRAGKLVSGLSS
ESKRWAESAKSLEGDLKNLVGNIMLAAGFVAYLGPFTMSYRNSLMDGWISFSRSQRVPVF
NVFSAERILADAVEVREWTLAGLPADQLSIDNAIIVTRGRRWPLIIDPQGQANKWIKTMD
RETLKTIKLTDASFLKTLENGIRFGNPILLENVEEKLDPSIDPVLQKNMIKKGGQIVLRL
GDQDVPYSNDFRFYMTTKLSNPHYLPEICIKVTIINFTVTPQGLEDQLLVDVVKAEKPQL
EELKNKLIVQISSDKDMLQELEDKILTMISKASGDILDDEILIETLGASKKTSEVIHVRM
AEAEQTATNINAAREEYRIVAERGSILYFVIADMGLVDPMYQYSLDFFSKLFNLRLYKSQ
KSDDIATRLQILVEDITKSFYFNICRGLFEKDKMLYSFLNAVRISLKAEKVTIKEWAYFL
KGSEDYDGDPLSISGLHLEGNTWSAIKALEEVNENFLGITNSFESNPEKWRVVKNCEDPF
KERFPSPYEGALTSFQKLIIGSVLKPEKLMLGLKMFVSRELGQVFIESPPFDLKGAFEDS
QSMSPIIFILSPGADPISDLMKLAAQNDMDGRFRMLSLGQGQGKTAEKFIDNGRRNGDWV
CLQNCHLAASWMGELERIQEQQVEGDIHPEYRLWLTSMPSSKFPVPVLQSGVKLTNEPPK
GLKANLGRTFQDVTQENYEGCTKSYEYKRMLYALAFFHAVILERRKFGAIGWNIPYEWMT
SDFVTSKSQLFMYLNEQAIIPYGTLKVLVAEINYGGRVTDDKDVRLITALLDKYFTPELM
SPNYTFSTSSIYRPPEGQSLDDIKEYIKGLPLEDDPELFGLHSNANITFNKKTVYEFREA
ICLIHPKISGGGSGKSSDDIVNEMAKDIEERLPKPMNVEKEQHPDTFSKNEIGAINSLGV
FVGQEIYRFNKLLVAMKNSLVQLQKAIRGDVVMGQDLERMYNSFLNQRVPKNWSDHAYPS
LKPLGSWVKDLIARVEFIHQWLTLGPRPTYWLSAFFFPQGFMTAALQMYARMTKTPIDTL
KFRTEVIPKTHHQITEGPSKGVNIHGLFMQGARWDTHRSRIEESEPGALFIEMPVVWLDP
ILLDAKIETLVYPAPMYKTSLRAGELSTTGHSTNFVLFLELPTTQNPVHWIRRGVALLCQ
LDD


>SteCoe_18549(CDS)
ATGGACGAACGGTTACCTCATGCATCAGAAAAGCAGCCACGCAGTCGGCTCGCAAGACTA
GCAGGTAGAGAAAGCGATTTGGCTTCAACAGCCGTCCTCAGCCTGAACCCAGGGCTGAAT
TATTCAAAAAACCACTTCAAAGGGCTATACAAAGCCGACTTAAAAAAAGAACTCGAGGAA
TGGGACCTCCCCTTTGCCTCAGCAAGAAATCGGCCAACAGGTGCTATCCTTACAAACACC
AAGCTACCTCCAATCACATACGAAGAATCTAACGAAGAAGATGATCAAACAACTCCAGGA
AACCGCGAGTTTGACTTCCACACTTTAACCAAAATGCTCAATGACTCAAGTAAACCTAGG
TCTGGATTAGCATCAGGAGCACAAGAAACCTTGTTTGTTGATAGAGAAAGCATGATATTC
AAAGAACTAAAAAAAATCATCACAGGTGAAGACGCTATATCTTTTTTTGCTAAAAATGGA
AATACAACACCAGTGAAATTTTTATATTGCAATAAAGCTTCGGCTAATAGTAAAATTTTC
AGACCTTATGATTTGGTTGTTGTACCAGAAAAAGAAATACATCCAGAGTATTTTACGATT
TCAGCACAAGGAGTTGTTCATGTCATGCCTAAAACTAGTGAAGGATCTGTGACAACTTTT
TATTCTTTGGCTGATTGGATGCATCAGAGCAAACTTTTTAATCTTTTGACGAGTATGAAA
TTTTTTAAGCATTATTTGAATGGAAAAGTTTTTTCTTTGTGGAGAGGGAATGTGCGTTAT
AATCATTATTGTGCTACGAGGAATAGGCTGAAGAGGAATTTGTTCCATGCTAAGCCGGTG
TTTATTGAGAGTTTACCGAAGATAAATGAGTTGCTTTATACGATGACGACTTGCCATTTG
TTGGATATTCCAGATAAAAGCAACGACCTTAGTAGCTATGTTGAAACTCAAAAGCAGCAA
AGGACTCAAGCAAAAAAAGACTTTGATGTGACAATGGAAAAACTTGGCAACGAATGCGAG
TCTGTAAAGCAAACAGTTCATGAAAGTGCCCAATTACCAGAAATGGAAGACATGGACCCA
GCTAAACTCGGGCAAAGAAACAAGAAAAAATCAATGGTCCAACAGAAACTCGAAGAAAAA
GAACGCAAGCACAAACTTCAACTAGCCGAAGAGCACAAAAGTATGCTTGGAAACTATATC
CGCCTTGTTGACTATATGTCTTCAGAAACCATAGTCATATTAATCCTTGACAGGACGAAA
AAATTCTATAAAAACTTAACCGAAAGAAGAAGCAATAAAATCTTCACAACAAAAGTCATC
TACGGGAAAGATTGCATTGTTTTTGACCCAAACGAAGAAGAATTCCTAGAAAAACTTGAA
GGAATCTTAGAAGGAATCCTAAGCGAAATAGGCAACCTATCTAGATTGACTTATAGATTT
GATGATATTTTAGCTACAGATAGATTAAGTCCTTTACAGATGGCTGATATAATAAAATCC
TCAGAGTCTTATCAGAATACAAGAAAAAGGATAAGAGAAAAATTCCATGATGACTTTGTT
GAAGCTCAAGCATATGTTGAAACTTATTTCGAAAAAGCTCGTTATGTTAATGATTATGTT
GAAACTTGGAATTTTGAAATATATAGAGCTGAAGGACATACAGTACAACAGATAAAAGAT
GAACTTAATAAAATTAAAGAAACAATGACTAAAGATGTGTCTATGTATGTTCATTCAGGA
CCAAATAATACGGTTAAAGGGATTTTAAATATAGATGGTAAGGCTATAAAGAACCATTTA
CATCAAAGTTTGACTAGTGCTCAAAATGATTTGAAATCATATTTAAACTCTATGGCTAGT
TCTAAAGCTGATCAATCTAATCAGGAATTAAGTGAAATGAACCTTAAACTAAGCCAACAA
CCAAGCCCATTATCTGATTTTATCAAGTATATGGAAGACTTGACAACAAGTAAAGCGGCT
ATACAAACTATAGAGTCCTCACGAGCTGAACTTGAAGAAATCGAGAAAACTTTGCGTCGG
GAGAAATTCTCAGACTCGCCAGGGACCAACCCGAAATTCATACAACTTGACTCTAATATT
AAGATTTGTAAAACCAATATTGACCAAGCGAATGATTTTATAGAAAAGAAAAAACCTGAT
ATGGAGAAAAAACTCGCATCAAGAGTTGAAAAGCTTAAAGTCACACTTTCTGAAGACTTA
AGCAAGAAATTAGATGAAGGGTCAATAATACTTGTAGAAGCCCATCCTACAGAAGCTCTA
AACGAACTGAAGAAAATCGAAACCCGGCTTAAAAAATGCGAAAACAACGCTGAGAAATTT
AAGCATTTCCAAGAAGTCTTTGCTGTAGGTGTTACAAGGATAAAAGAGCTTGAGGACACA
TCTTTTAAATTCAAGTCCAAAAACAAGCTCTGGAACCTAAGAAAAGAATGGGACGAATTT
CATGGAAAACTCATGAACGACGATTTTTTAAGCCTTGGACCCGATTTGAAAAAATCCATA
TCCAGATTCGAAAAAGAGTCCGGCAATCTTAAACGTGAGCTTATGATGTATTCAAAAGAA
GGTAAAGATCTTGTCGCTGAAGACTTTTACACCCGTGTCAAAGAAGTTTCAGCCTACTTG
CCAATAATCGAATGTTTAGGTATCGAAGCTCTAAAAACCCGTCATTGGATAAAAATCCAC
AACGCTTTACCTAAAGAAAAAGAATACACCGAAGGAGGTTTTTTTTCTTTATCTGAACTT
ATAGACCATGGAGTTATGCAAATTCGTGATAAAGTTGAAGAAATATCAGCAACAGCCGCA
GGAGAATTTTCATTAGAAAACACAGTAGAAGAAATAAGACAGGCTTGGAGTACAACAAAT
TTCGAGCTTAGCAATTATCGAGAACAAAAAGATAAATTTTATATAACAAAAGTTGAAGAT
ACTCTAACACAACTTGAAGATCATCAAGTATCAGTACAGACTATGTTAGGTAATAGACAT
GTTGCAGAAATCAAAGGGATGATTGAAGATTGGGATAAAAAACTTAGACTGGTTCAAGAT
GTGATTGATGAATGGCTTATATGTCAGAAACAATGGATGTATTTAGAAAACATATTTAGT
GCACCGGATATACAAAAACAATTACCTAGAGAAACAACGAAATTCCAAGGTGTTGATAGG
TTTTGGAGAGAACTTATGTTAAGGACTAATAAAAACCCTGCAGTTATTGAAGCATGTATA
TCAGAAGGTCTTTTAGACAAGTTTAAACGTAATAACAAAATATTGGAAGAGATCAAAAAA
TCCTTAGACGAGTATTTAGAAAGTAAAAGACTAGCTTTTCCAAGGTTTTACTTTTTAGCT
GATGAAGAATTATTAGAAATCTTAAGTCAAACAAGAAACCCACGTAAAGTTCAAGACCAT
TTACGTAAATGTTTTGATAATATGGACAAAATTATTTTTAAAGAAGAAAAAGAAGGGCTT
ACTGTTACTGGGATGATCAGTGGGGAACATGAAACTGTTAATTATTCACAAGTTGTAGTT
CCTGAAGGAAATGTTGAGCATTGGTTAACTAAAATTGAAGAAATGATGAAACTTTCATTA
TATGATTTGACGAAAAAAGCTATACAAGTATATCCTAAAGATGAACTAAATCGTCGAGCT
TGGTTTTTTGAATATAATATCCCAGCACAATGTTTACTTGTTGTAGATCAAATCAAATGG
ACTTTTTGGGCAACTGAAGCTATAGACAATGTTGAACATGAACGTAATAAAGGTGCTATA
AAAGAGTTTTGGGAGTTTCTTAGATTACAAATTAAAGATAGTGTTGGTATTGTAAGAGGG
GAATTAACTGGTCTTCAAAGAACTTTAATGGGTGCATTGATAACTTTAGATGTACATGGA
AGAGATGTTATTGATAGTTTAGTACAAAAAGATGTTAAAAGCTTATGGGATTTTGAATGG
AGTAAACAATTAAGATATTATTGGGAAAGTGATATTGATGATTGTAGAGTACGTCAAACT
AATGCTAAGTTTAGATATTCTTATGAATATTTAGGTAATGGGCCAAGGTTAGTTATAACT
CCACTTACAGATAAATGCTATTTAACATTAACTGGAGCTTTGCATCTTTATTATGGAGGA
GCACCTGCTGGACCTGCTGGGACTGGGAAAACAGAGACAACTAAGGATTTGGGTAAAGCT
TTAGCTATACAATGTGTTGTATTTAATTGTTCTGATGGATTAGATGTGAATATTATGGCT
AGGTTCTTTTCAGGATTAGCCCAAGCTGGTGCTTGGTCTTGTTTTGATGAATTTAATAGA
ATTGATATTGAAGTACTTTCTGTTATTGCCCAGCAGATCTTAACAATACAACATGCTGTG
AGGAATAATCAAGAAGAATTTGAGTTTTTTGGTAGGAATATTAAACTTGATAAGCGTTTT
GGTGTTTTTATTACTATGAATCCTGGCTATGCTGGACGTACAGAACTTCCTGACAACTTA
AAAGCTCTTTTCCGCCCTGTAGCTATGATGATCCCTGACTATGCTATGATTGCTGAAATC
ATGCTTTTCTCTGAAGGTTTCGAAAAAGCTCGAGTTTTAGCAAGGAAAATGGTCCAACTC
TATAAACTAGCCTCAGAACAACTTTCTAAACAAGACCATTACGATTTTGGTATGCGCGCA
GTCAAATCAGTCCTTGTCATGGCAGGACAATTACGTCGTAAAAACCCTCAATTATCAGAA
GATGTGATACTTATTCGTGCAATGAGAGATTCTAATGTCCCTAAATTTTTAGAACAAGAT
CTTCCTCTTTTTAGAGGTATCATAACAGATCTTTTCCCTGAAGTTGTCGTCCCATTTGTA
GACTATGGGAATCTAGAAAGGTCAATACGTGAACAGTTGCTTAAAAAAGGTTTACAAGCT
TTAGATGCATTTGTATTGAAAATCATCCAATTGTTTGAAACTATGCTTGTAAGACATGGG
AATATGATTGTTGGACCAGCTGCTACAGGTAAGACTAATTTATATAAAACCTTAGCTGAT
GCTTTAGCTCAATTACATGATGAAGAAGAAGCTGATGAGACTAAGAAAAAAGATCCTGAC
CATCAGAAAATATTATATTATCCTTTAAACCCTAAAGCTATTAGTATGGGAGAATTATAT
GGGCAGACTAGTTTGACTGGGGATTTCACAGATGGAATAGTCCCAATATTAGTAAGAAGT
GCTAAATCTGATAACACCCCAGCTAAGAAATGGATTGTTTTTGATGGCCCGGTTGACTCT
TTGTGGATTGAAAGTATGAATACTGTACTTGATGATAACAAGATGTTATGTTTAACTAGT
GGTGAACGTATAAAACTCCCTGATACTATTACTATGCTTTTTGAAGTACAGGATTTAGCA
CAAGCTTCCCCTGCTACAGTCAGTAGATGTGGCATGGTTTATTTAGACCCTGTTCATCTA
GGCTGGTTACCTCTTATTGATTCTTGGCATGATAAATTTAAAATCCAATTACCAACTTAT
GCTGATCATGTTGTCGAACAGACTAAAAAGTTCATCTCAACTCTTTTACCTTTTGTTAAA
CATGACTGTAAAGAAGAAATCCAATCTAGTAGTACAAATCTCGTAACTTCATGTTTAAAT
CTTATAACTTCTTTAGTAAAACAAGAACTCATAGCAAAAAAACGTCCTGATGATGCTGAG
AACCTTATAAACGTTTATTTAATATTTGCCCTTACCTGGTCTTTAGGAGCTAATCTTAAC
GATGTCTCACGTTTATTATTTGATAAAAAAATGCGAGTCGAAATCGAAAGTTTATATAGG
CATTTCCCTTATTCTAACACAGTATTTGATTATTGTATTGATGATGATATGTGTGAATTT
GTCCCATGGGAAAGTAGAGTGCCAAGTTTTAATTACAACAGCAAACAACCTTTTTTCATG
ATTTTAGTCCCAACAGTCGACACTGTTCGTGATAGGTTTATATTAGAAGTCTTAGCTAAA
AAATCTCATCACTTATTATTTAGTGGGAATACTGGTGTTGGTAAAACTGTTATTATAAAA
GATTATCTTAATGCTGGAAATAATGATTGGTTCGTATCTACTGTTATAAACTGTTCAGCT
CAGACAAGTACACAAAACATAAATGATGTTTTTGAAGATAAACTTGAAGCTCCAAGGAAA
AAAATACGTAGACCACCACCAGGGAAAAAAATGATTATGTTTATTGATGATGTTAATATG
CCAGCTTTAGATCTTTTTGGTTCACAACCTCCTATAGAGTTATTAAGGCAGATAATCGAA
GCTGGTTTTTATGATTTGAAGAATTATTTTTTTAAAAATGTAGAAGATGTGATTTTTGTC
GCTGCTTGTGCACCACCAGGAGGTGGGAGGAATCAGGTATCACCAAGATTTTTTAGACAT
TTTAATATGATATGGCAAATACAATTAGCCCAATCATCAATGGAAGCAATTTTCTCATCT
ATATTAAGAGGGTTTTTAGATGAACACCCTGATGAGAATTTGTCTGATCATGCTGACCCA
ATAGTTAAAACCAGTGTTGAAAATTATATCAAAATATGCAATGACCTTTTACCAACACCA
AGTAAAAGCCATTATACTTTTAATCTTAGAGATTTAAGTAAGGTTGTTCAAGGAATGCTT
ATGATATCATATGAAAATCTTAGAAATGTTGATACTTTATTACTTCTTTGGTTACATGAA
TGTTGTAGGGTTTTTAGAGATAGACTGGTTGATGATAAAGATAGGAATTGGTTTAATGAG
GAATTAGAAAGGAAAATGCGAATGAATTTAAATGTGGATATACCAAGTCGTGAGAAATGG
GCTGATATAATTTTTGGGGATTTCATGAGTGGACCTTATAAGGAGTATGTGAAAATTGAA
TATGGGAATAAACTTTTTGATAGACTTGCCTTAGCTTTAGAACAGTATAATTCTGAGTTT
TCAAGTAGAATGAACTTAGTTTTTTTCAAAGATGCTATAAATCATTTAACAAGAATATGT
AGGATACTTCGACAACCAAGAGGAAATGCTTTATTAGTAGGTGTTGGGGGTAGTGGAAGA
CAATCTTTAGCACGTCTTGCTGTTAGTATGGCTGGATATAGACCTTTTTCTATTGAAATC
ACAAGAATTTATGGTGTTGTTCAGTTTAGAGAAGATTTGAAAGTACTTCTTAAAAGCGCA
GGAGCCCAAAATGAACAGATCGCTTTTATATTTTCGGATACACAAATTGTAAAAGAAAGC
TTTTTAGAAGATATAAACAATGTTTTAAATACAGGTGAAGTGCCTAATTTATATGAGATT
CAAGATACTGAAGAAATTATTGGGCTTGTGAGGCAGAGTGCAAAAGAAGCAGGAAGGCCT
GATACTAAAGATGCGATATTCCAACATTATGTTCAGTTATGTAGAGACAATTTACATATA
GTTTTAGCTTTTAGTCCTGTTGGGGAACAGTTTAGAGTGAGATGTCGTCAATTCCCATCA
ATTGTAAACTGTTGTACATTAGACTGGTACAGCGCTTGGCCAAGAGATGCCCTTTTCTCA
GTCGCCCAAAGATTTTTCAATGAAAACGAGCATTTAGGTATCAAAGACCTTAAAGACCAA
CTCTGTAACATCTGCGTCGAAATCCACTCCTCAGTAACCAAAAAATCAAAAGACTTCGAA
CTTGAACTTCGACGTAAAAACTATACAACTCCAACATCTTACCTTGAACTTATAAAACTT
TATCTTGACATGCTTACTTTACAACAAAAAAAAGTCCCAGAACAAATCAACAAATACGTC
ACAGGGCTCAAAAGACTTAAAGAAACAAACGAAATGGTCTCAGATATGCAAAAAGAGCAA
GCCGAGCTCAAAATCATCCTGAAAAAAAGCTCAGAAGAAAATGCTCGTATGCAAATTGAA
CTACAAGGCAAACAAGCTGATGCAAAAGTTAAAGAAGAAGCCTGTGCTAAAGATGAAGCA
GATTGTTCAGTAACAATGAAAGAAGTCTCAGAAATAAAAGATGAATGTCAAAAGGATTTA
GATGAAGCATTACCAGCTTTAAATGCGGCAAATCGAGCTTTAGGAAATCTTAACAAAAGT
GATATTGTCGAAATAAAAAGTTACCCAAAACCCCCACCAGGTGTAGAAATGGTCATGAAT
GCTGTGTGTTTATTATTTAAAGAAAAACAAACTTGGGATTCAGGGAAAAAACTCTTAGGT
GATATGAACTTTTTACAAAACTGTATGAATTTCCCTAAAGATGATATTTCTAATCAAACA
TTACGTAAACTTCAAACATATATGGCAAATCCTGAATTTAACAAAGATTCAGTAGCTAAA
GTGTCAATAGCTGCAGGATCATTATGTGAATGGGCAATGGCTATGGATAAATATGCAAGA
ATATCAAGAAATATAGAACCCAAAAGAAATCGTTTAGCTCAAGCTGAGACAAATTTAAAA
GTAGCTCAAGAGCAGTTAAATGAAAAACAAACAACATTAAGAGCGATACAAAAAGAAGTT
TCTGAACTTGAGGCAACATTTCAAGCTAGTGTAAAAAAAGGTGAAGAACTTAGGAAAAAA
AGTGAACTTACTGAAGCAAGGCTTGATAGAGCTGGGAAATTAGTCTCAGGGCTTAGTAGT
GAAAGTAAAAGGTGGGCAGAAAGTGCTAAATCTTTAGAAGGGGATTTGAAAAATTTAGTA
GGGAATATTATGCTAGCGGCTGGATTTGTAGCTTATTTAGGTCCTTTTACAATGTCTTAT
AGGAATAGTTTGATGGATGGGTGGATATCTTTTTCTAGGTCTCAAAGAGTTCCTGTTTTT
AATGTGTTTTCAGCTGAAAGGATATTAGCTGATGCTGTTGAGGTCAGAGAATGGACTTTA
GCTGGTTTACCTGCTGATCAGTTGTCAATAGATAATGCGATAATTGTTACAAGGGGAAGA
AGATGGCCACTTATTATCGATCCACAAGGTCAAGCAAATAAATGGATTAAAACAATGGAT
AGAGAAACTTTAAAAACTATAAAACTCACAGACGCTAGTTTCTTAAAAACCTTAGAAAAT
GGGATTCGTTTCGGGAACCCAATTTTATTAGAAAATGTTGAAGAAAAACTAGACCCAAGT
ATTGACCCGGTGCTACAGAAAAACATGATAAAAAAAGGAGGACAGATTGTTTTAAGACTT
GGTGATCAAGATGTCCCTTATAGTAATGATTTTAGATTTTACATGACAACTAAATTATCA
AATCCTCATTATTTACCTGAAATTTGTATTAAAGTTACAATTATTAACTTTACTGTCACC
CCACAAGGTCTTGAAGATCAGTTATTAGTTGATGTGGTTAAAGCTGAAAAACCTCAATTA
GAAGAGTTAAAAAATAAACTTATTGTTCAGATATCTAGCGATAAAGATATGTTACAAGAA
CTCGAAGATAAGATTTTAACAATGATTTCTAAAGCAAGTGGGGATATTTTAGATGATGAG
ATACTTATAGAAACACTTGGAGCTAGTAAAAAAACTAGTGAAGTCATCCATGTAAGAATG
GCTGAAGCTGAGCAAACTGCTACAAACATAAACGCAGCACGTGAAGAGTATAGAATTGTT
GCTGAAAGAGGCTCAATATTATATTTTGTTATTGCCGATATGGGTTTAGTAGACCCTATG
TATCAGTATTCATTAGATTTCTTTAGTAAACTTTTCAATCTTCGACTTTACAAATCACAG
AAAAGTGATGATATAGCCACAAGGTTACAAATACTAGTTGAAGATATAACAAAATCATTT
TATTTCAATATCTGCAGAGGGCTTTTTGAAAAAGATAAAATGTTGTATTCATTTCTTAAT
GCTGTGAGGATATCGTTAAAAGCTGAAAAAGTTACAATTAAAGAATGGGCTTATTTCCTT
AAAGGTAGTGAAGATTATGATGGTGATCCTCTTTCTATATCAGGATTACATTTAGAAGGT
AATACATGGTCTGCGATAAAAGCTCTTGAGGAAGTTAATGAGAATTTTTTGGGGATTACG
AATTCTTTTGAAAGTAATCCTGAAAAATGGAGGGTTGTTAAGAATTGTGAGGATCCGTTT
AAAGAAAGGTTTCCTAGTCCTTATGAAGGAGCTTTGACAAGTTTCCAGAAACTTATTATT
GGCAGTGTTTTGAAGCCTGAAAAACTTATGCTTGGATTGAAAATGTTTGTTAGTAGGGAA
TTAGGACAGGTTTTTATTGAGTCACCACCTTTTGATCTTAAAGGAGCATTTGAGGATTCA
CAAAGTATGAGTCCTATTATTTTTATATTAAGTCCAGGAGCTGATCCTATAAGTGATTTA
ATGAAACTTGCCGCACAAAATGATATGGATGGGAGGTTTAGAATGCTATCTCTTGGGCAG
GGACAAGGAAAAACTGCTGAGAAGTTTATAGATAATGGAAGAAGAAATGGGGATTGGGTT
TGTTTGCAGAATTGTCATTTGGCTGCATCTTGGATGGGTGAGTTAGAAAGAATCCAAGAA
CAACAAGTTGAAGGGGATATACATCCTGAATATCGTCTATGGTTAACCTCAATGCCAAGT
AGTAAATTCCCAGTTCCAGTTCTTCAAAGTGGAGTTAAACTAACAAATGAACCACCAAAA
GGTCTTAAAGCAAACCTTGGAAGAACTTTCCAAGACGTTACACAAGAAAACTACGAAGGT
TGTACAAAATCATACGAATACAAACGTATGCTTTACGCACTAGCTTTTTTCCATGCAGTA
ATTCTAGAAAGGCGTAAATTCGGAGCTATAGGTTGGAATATCCCTTATGAATGGATGACA
AGTGATTTCGTTACAAGTAAATCACAACTTTTCATGTATTTAAATGAACAAGCTATTATC
CCATATGGAACCTTAAAAGTTTTAGTTGCAGAAATTAATTACGGTGGTCGTGTTACTGAT
GATAAAGATGTTAGACTTATAACTGCTTTACTTGATAAATACTTTACCCCTGAGCTTATG
AGTCCAAATTATACTTTTTCAACATCTTCAATATACAGACCACCAGAAGGACAAAGTTTA
GATGATATTAAAGAATATATTAAAGGATTACCATTAGAAGATGATCCTGAACTTTTTGGT
TTACATAGTAATGCAAATATTACATTTAATAAAAAAACAGTTTATGAGTTTAGAGAAGCG
ATTTGTTTAATACATCCAAAAATATCAGGAGGAGGTTCAGGGAAAAGCTCTGATGATATT
GTTAATGAGATGGCGAAAGATATTGAAGAACGTTTACCTAAACCGATGAATGTTGAAAAA
GAACAACATCCTGATACTTTTTCTAAGAATGAAATTGGAGCTATAAATTCATTAGGAGTT
TTTGTTGGACAAGAAATTTATAGGTTTAACAAACTTTTGGTTGCGATGAAGAACTCTTTG
GTCCAATTGCAAAAAGCTATTAGAGGAGATGTGGTTATGGGTCAAGATCTTGAACGGATG
TACAACAGTTTTTTAAATCAAAGAGTGCCGAAAAACTGGTCAGATCATGCTTATCCGTCT
TTAAAACCTTTAGGATCTTGGGTTAAAGACCTTATCGCTCGTGTTGAGTTTATACATCAA
TGGTTAACTTTAGGTCCAAGGCCAACTTATTGGCTTTCAGCTTTCTTTTTCCCTCAAGGT
TTTATGACTGCAGCACTTCAAATGTATGCGAGAATGACTAAAACTCCAATTGATACTCTA
AAATTCAGAACTGAAGTCATTCCTAAAACTCATCATCAAATCACTGAAGGACCAAGTAAA
GGGGTTAATATTCATGGATTATTTATGCAAGGAGCAAGATGGGATACTCATAGAAGTAGG
ATTGAAGAAAGTGAACCTGGAGCTTTGTTTATAGAAATGCCTGTTGTTTGGTTAGATCCT
ATTTTACTTGATGCAAAAATAGAAACTTTAGTTTATCCTGCGCCTATGTATAAGACTTCA
CTTAGAGCTGGTGAATTAAGTACAACTGGTCATTCGACAAACTTTGTTTTGTTTTTAGAA
CTACCTACAACTCAGAACCCTGTTCATTGGATTCGACGTGGGGTTGCACTTTTGTGCCAG
TTAGACGATTAG