Identifiers and Description

Gene Model Identifier

SteCoe_18560

Standard Name

None

Aliases

None

Description

ATP_bind_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004418103.0144087850653746e-40GPN-loop GTPase
WormBaseWBGene000135503.3057006267607343e-37
Oxytricha TrifallaxContig18293.0.g1071.3336148155022614e-34Conserved hypothetical ATP bin
ding protein

Saccharomyces CerevisiaeYLR243W1.9792598779469045e-32Putative GTPase with a role in
biogenesis of RNA pol II and
polIII; may be involved in ass
embly of RNA polymerases II an
d III and in their transport i
nto the nucleus; may have a ro
le in sister chromatid cohesio
n; contains a Gly-Pro-Asn moti
f in the G domain; similar to
Npa3p and Gpn2p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18560(Protein)
MAQFSRYAQIVMGPAGSGKSTYCLIMQQHAGLLGKTIKIINLDPAAEIICYKPDLDIRKL
VTLDDVMEETELGPNGGLVMALEYLLEHTDWLKETLDEFADDDYIIIDCPGQIELYTHMT
IIKDFCKTMHELSYNICGIYTIDCTFISDASKFISASLMALSAMNQMEIPHVNVLTKCDL
IKNKKELEDMLDTEPRDLLFDLPVYTTKFKNMSEKIANVLSDFNLVNYIPLDISDEETIS
AVMYQVDICIQYGETLEVYPKDNEDIEDDMEVDR


>SteCoe_18560(CDS)
ATGGCACAATTTTCAAGATACGCACAAATAGTCATGGGTCCTGCAGGTTCAGGTAAATCA
ACTTATTGTCTTATTATGCAACAACATGCTGGACTTCTTGGAAAAACAATTAAAATCATC
AACTTAGACCCAGCGGCTGAAATTATATGCTACAAACCTGACTTAGATATTAGAAAACTT
GTCACTTTAGATGATGTTATGGAAGAAACTGAACTTGGGCCTAATGGTGGACTTGTCATG
GCTTTAGAATATTTACTTGAACATACAGATTGGCTTAAAGAAACTTTAGATGAATTCGCT
GATGATGATTATATAATCATAGACTGCCCAGGTCAAATTGAACTATATACACATATGACT
ATAATAAAAGACTTTTGTAAAACTATGCATGAATTAAGTTATAATATTTGTGGAATTTAT
ACAATTGACTGCACTTTTATCTCTGATGCTTCTAAGTTTATATCAGCATCGTTAATGGCA
CTTTCGGCTATGAATCAAATGGAAATTCCTCATGTTAATGTTTTGACGAAATGCGATCTT
ATTAAAAATAAAAAAGAACTTGAAGATATGTTGGATACTGAGCCGAGGGATTTACTTTTT
GATTTGCCTGTTTATACAACAAAATTTAAAAATATGTCAGAGAAGATCGCTAATGTACTT
AGTGATTTTAATTTGGTTAATTATATACCTTTGGATATTAGTGATGAAGAGACTATTTCT
GCGGTTATGTATCAAGTTGATATATGTATACAGTATGGAGAAACTTTAGAGGTTTATCCT
AAAGATAATGAAGATATTGAGGATGATATGGAAGTTGATAGGTAA