Identifiers and Description

Gene Model Identifier

SteCoe_18608

Standard Name

None

Aliases

None

Description

CRAL_TRIO_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20661.0.g892.031092662734811e-42CRAL/TRIO domain

Tetrahymena ThermophilaTTHERM_002921403.0144087850653746e-40Putative phosphatidylinositol/
phosphatidylcholine transfer p
rotein; CRAL/TRIO, N-terminus
family protein
Saccharomyces CerevisiaeYMR079W7.984904245686979e-30Phosphatidylinositol/phosphati
dylcholine transfer protein; i
nvolved in regulating PtdIns,
PtdCho, and ceramide metabolis
m, products of which regulate
intracellular transport and UP
R; has a role in localization
of lipid raft proteins; functi
onally homologous to mammalian
PITPs; SEC14 has a paralog, Y
KL091C, that arose from the wh
ole genome duplication
WormBaseWBGene000119620.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18608(Protein)
MERQRPAEIESLLESLNPEERKTLDRFREAVPGSWNDHTLARFLRARKFVFEKALEMFSK
YVEWRREQNVDSIESFDFPEAPALKEIYPHGFHKTDRYGRLIYIERYGFIDMKRIFQITT
EERMIRYYIREYESMISYRIPSCCVAAGYRVEQSLTILDLGGSSTKLMKSSVYNFVKLAS
SIAQDYYPEILGKMFIINTPMLFSVAWKVIRPWIDERTQKKITTEGSKYQKKLLELVAPE
NLPDFLGGTCQCAGGCLSSDAGPWRDPDIRSRISSERI


>SteCoe_18608(CDS)
ATGGAAAGACAAAGGCCTGCTGAAATCGAGTCTTTGCTCGAGTCTCTGAACCCCGAAGAA
CGCAAAACCCTTGACAGGTTCAGAGAAGCAGTACCAGGAAGCTGGAATGACCATACTCTA
GCGCGTTTCCTCCGAGCTCGTAAATTTGTCTTTGAAAAAGCCTTAGAAATGTTTTCAAAG
TACGTCGAGTGGCGTCGCGAACAAAACGTTGACAGCATTGAATCCTTTGATTTCCCTGAA
GCCCCAGCTTTAAAAGAAATCTACCCACATGGCTTCCATAAAACCGATCGATATGGGAGA
CTTATTTACATAGAACGATATGGGTTTATTGACATGAAACGTATCTTTCAAATAACAACT
GAAGAAAGGATGATAAGGTATTATATAAGAGAATATGAGAGTATGATTTCTTATAGAATC
CCATCATGCTGTGTTGCTGCAGGGTATCGTGTTGAGCAGAGTTTGACTATTTTAGACCTT
GGGGGATCTTCTACTAAGCTCATGAAGTCTAGTGTTTACAATTTTGTGAAGTTGGCTTCG
AGTATTGCCCAAGACTATTACCCAGAGATATTAGGTAAGATGTTTATTATCAATACGCCA
ATGCTTTTCTCTGTAGCTTGGAAGGTTATTCGTCCATGGATTGATGAACGCACGCAGAAA
AAAATCACTACTGAAGGAAGTAAATATCAGAAGAAGCTGTTGGAGTTGGTAGCTCCGGAA
AACCTCCCTGATTTCCTTGGTGGAACCTGCCAATGTGCTGGCGGCTGCTTGAGTAGTGAT
GCAGGCCCTTGGAGAGACCCTGATATCCGTTCTAGAATTAGTTCTGAAAGAATTTGA