Identifiers and Description

Gene Model Identifier

SteCoe_18678

Standard Name

None

Aliases

None

Description

VWA_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18962.0.g371.9792598779469045e-32von Willebrand factor type A d
omain

Tetrahymena ThermophilaTTHERM_004718301.603810890548638e-28Ubiquitin interaction motif fa
mily protein
Saccharomyces CerevisiaeYHR200W1.7587922024243116e-25Non-ATPase base subunit of the
19S RP of the 26S proteasome;
N-terminus plays a role in ma
intaining the structural integ
rity of the regulatory particl
e (RP); binds selectively to p
olyubiquitin chains; homolog o
f the mammalian S5a protein
WormBaseWBGene000044663.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18678(Protein)
MEATVICIDNSEYARNGDYSPNRWESQQEAVNMIAGTKTNENPGNSVGVLAMAGTRAEVL
VSPTNDMAKILQAMYDIKIHGNIDFYSSLQIAQLALKHRPNKEQRQRIIAFVCSPVRHDS
EKFRQIGHSLRRNNIALDIVCFGCMEEIEKLQELQKNVNNGDNSHFISVPPGLGLLCDAL
VNTPVLHGGSGQMFEEHGGIDPSLDPELATALRLSLEEQKKKQEDEGTKVEAPAVSVAED
EEEKLLQEAIRMSLMCDNEQKVEEKVEDKMEGVEEQDHFENADFLKDMLTSVEGVDMNDP
TIQETLKILKMEGREEKKEEERKDDVMEEDKKDSDS


>SteCoe_18678(CDS)
ATGGAAGCCACAGTGATATGCATTGACAATTCCGAATACGCCCGCAATGGTGACTACTCT
CCAAACCGATGGGAGTCTCAACAAGAAGCCGTAAACATGATAGCCGGGACAAAAACCAAT
GAAAACCCAGGTAACTCTGTAGGTGTCCTAGCAATGGCCGGCACCCGTGCTGAAGTCCTA
GTTTCTCCTACAAATGACATGGCAAAAATCCTCCAAGCCATGTACGACATCAAAATCCAT
GGAAACATCGACTTTTATTCATCCTTACAAATAGCCCAACTAGCTCTTAAACATCGTCCA
AACAAAGAGCAGCGTCAAAGAATCATAGCTTTTGTATGTAGTCCTGTACGTCACGATTCA
GAAAAATTTCGTCAAATAGGTCATTCACTTAGAAGAAACAATATAGCTTTAGATATAGTA
TGTTTTGGATGTATGGAAGAAATTGAAAAACTCCAAGAACTTCAAAAAAATGTTAACAAT
GGAGATAACTCTCATTTTATATCTGTTCCCCCTGGACTTGGACTTTTATGTGATGCTTTA
GTTAATACACCTGTTTTACATGGAGGATCTGGGCAGATGTTTGAAGAACATGGTGGTATT
GACCCTAGTCTTGATCCTGAATTAGCAACTGCTTTAAGATTAAGTTTGGAGGAACAGAAA
AAAAAACAAGAAGATGAAGGGACAAAAGTTGAAGCACCAGCTGTATCTGTTGCAGAAGAT
GAAGAAGAAAAATTGTTACAAGAAGCTATTAGAATGTCGTTGATGTGTGATAATGAACAG
AAAGTTGAGGAAAAAGTTGAGGATAAGATGGAAGGAGTTGAGGAACAGGATCATTTTGAA
AATGCTGATTTTTTGAAGGATATGCTTACGTCGGTTGAAGGAGTGGATATGAATGATCCG
ACTATACAGGAGACGTTGAAAATTTTGAAGATGGAAGGAAGGGAGGAAAAAAAAGAGGAG
GAGAGGAAAGATGATGTTATGGAAGAGGATAAAAAAGATAGTGATAGTTAG