Identifiers and Description

Gene Model Identifier

SteCoe_18682

Standard Name

None

Aliases

None

Description

Peptidase_M24 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002833303.5722699376192174e-67Protein associated with macron
ulear microtubules; sequence s
imilarity to human transcripti
on elongation factor FACT 140
kDa subunit, yeast Spt16/Cdc68
, and Xenopus DUF140

Oxytricha TrifallaxContig22561.0.g341.9503933001302485e-65FACT complex subunit (SPT16/CD
C68)

WormBaseWBGene000188492.138865964899539e-62
Saccharomyces CerevisiaeYGL207W2.2856936767186716e-49Subunit of the heterodimeric F
ACT complex (Spt16p-Pob3p); FA
CT associates with chromatin v
ia interaction with Nhp6Ap and
Nhp6Bp, and reorganizes nucle
osomes to facilitate access to
DNA by RNA and DNA polymerase
s; SPT16 specifically required
for diauxic shift-induced H2B
deposition onto rDNA genes; s
ome mutations cause reduced nu
cleosome occupancy over highly
transcribed regions of the ye
ast genome

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18682(Protein)
MESAEKAGKLMEKLFVVAIEKVETIIDEELKESHEAVAKEIESAFGSAVRKLGYSPSSCA
FLSAQVQSGGNFDAKKPNDSLILSGDLVFISIRVSVDSCEVHCVRTIIINPTDDVKKAYN
FLYDLSQSASALQKATPLSTFCSKLRSVAENKDPDLTKYLPANLGYGSKGKSIEDSSKDM
TIPGEVYTIALTLSGFPVLDGFKSQRSPISIAIYDSYFIQEIGNCKLLTETVKEFQDISY
SLEDEEKPSQKIDIAELKNSGVVRSSRLRHQVNSEQLEKDRKRKERQVQLRQEKQEELKR
RFSGYDADNRRGTTQQKSLCEVVAYSSRENFPEAARKNQIYVDTRHESVLLPIQGQIVPF
HVSTIKNVSKNEEGKHFYLRINFLHPGVGIIKDSKYILPELKEPNNFYIKELTFRSSNPR
NLNNSFKTLKELIKKVKAMEVEEKEKGTLIDQEKLIMIKGKRPSLQDVTIRPNISGKKTQ
GSLEGHQNGIRFTSNKGDKVDIIYSNIKHAVFQPVENELIVLIHFRLKNSIMVGSKKTTD
VQFYTEAGIQSDDLDMRRRAGMDLDEIQAEQRERKFKEKLNKEFKNFVESVQAISGETID
FDIPYRELGFHGVPYRSNVFIMPSVNCLVSLIDQPFFVISLSDIEVAHFERVQFTLKNFD
LVLIFKDYSITPIRICTIPAEFLESIKDWLNDIDIVYSESLNPLNWGNVMKEITRDLQGF
IEEGGWDFLQESDNEGESGQSDDELEVDSEFNEEDVGSEFEDDESEFSDESEEENDDESE
ADFDSEDESGLEWDELEAQAKKMDAKKNPKVIKEVKPSNKRTKK


>SteCoe_18682(CDS)
ATGGAGAGCGCGGAAAAAGCAGGCAAACTCATGGAGAAACTCTTTGTTGTAGCTATAGAA
AAAGTAGAAACCATCATAGATGAAGAGTTAAAAGAATCTCATGAAGCTGTGGCTAAAGAA
ATCGAATCTGCTTTTGGATCTGCAGTTCGTAAGCTTGGCTATTCTCCTTCAAGTTGTGCT
TTTCTCTCAGCGCAAGTGCAAAGTGGCGGGAATTTCGATGCAAAAAAACCAAACGATAGT
TTGATTCTAAGTGGTGATCTTGTGTTTATATCTATTCGGGTTTCAGTTGACTCTTGTGAA
GTCCACTGTGTCCGCACCATTATTATCAACCCAACAGATGATGTAAAAAAAGCATATAAT
TTTCTATACGATCTAAGTCAGTCTGCATCAGCTTTACAAAAAGCTACTCCGCTATCGACC
TTTTGTTCTAAACTTAGGTCTGTGGCTGAAAATAAAGACCCTGATTTAACTAAGTATCTT
CCTGCTAATCTAGGATATGGGTCTAAAGGAAAATCTATTGAAGATTCGTCAAAAGATATG
ACAATTCCAGGTGAGGTTTATACTATTGCTTTAACTTTATCAGGGTTTCCAGTTTTAGAT
GGGTTTAAGTCACAGCGTTCACCTATAAGTATTGCAATTTATGATAGTTATTTTATTCAG
GAAATCGGAAACTGTAAGCTTTTAACTGAAACAGTTAAAGAATTCCAAGATATTAGCTAT
AGTTTAGAAGATGAAGAAAAACCATCTCAAAAAATTGACATTGCGGAGCTTAAAAATAGT
GGAGTTGTGAGAAGTTCTAGGCTTAGGCATCAAGTTAATTCAGAACAATTGGAAAAAGAT
AGGAAAAGAAAGGAAAGACAGGTTCAGTTAAGACAAGAAAAACAAGAAGAACTTAAAAGA
CGCTTTTCAGGATATGATGCAGATAATAGAAGGGGAACAACACAACAAAAATCTCTTTGT
GAGGTTGTTGCTTATTCTTCAAGAGAGAATTTTCCTGAAGCTGCTAGGAAAAATCAGATT
TATGTTGATACTAGACATGAAAGTGTACTTCTTCCAATACAAGGACAGATTGTCCCGTTT
CATGTTTCAACTATAAAAAATGTTAGTAAAAACGAAGAAGGCAAACATTTTTATTTGAGA
ATTAACTTTTTGCATCCAGGTGTTGGGATAATCAAAGATTCCAAATACATTCTCCCTGAA
CTTAAAGAACCAAACAACTTTTACATTAAAGAACTTACTTTCCGAAGCAGCAACCCAAGG
AATCTAAATAATTCCTTTAAAACCTTGAAAGAACTGATAAAAAAAGTCAAAGCTATGGAA
GTTGAAGAAAAGGAAAAAGGCACACTAATTGATCAAGAAAAGCTAATAATGATCAAAGGC
AAAAGGCCAAGTCTCCAAGATGTGACAATAAGGCCAAACATCTCAGGTAAAAAAACTCAA
GGATCTCTTGAAGGTCATCAAAACGGTATAAGATTTACCTCAAACAAAGGAGATAAAGTC
GATATCATATATTCAAACATAAAACACGCAGTCTTCCAACCAGTCGAAAACGAGCTTATT
GTTCTAATTCATTTCAGACTAAAAAACTCAATAATGGTTGGATCAAAAAAAACGACTGAC
GTTCAATTTTATACTGAAGCTGGGATTCAAAGTGATGATTTAGACATGAGAAGAAGAGCA
GGTATGGATTTAGATGAAATTCAAGCAGAACAACGAGAAAGGAAATTTAAAGAAAAACTT
AACAAAGAATTTAAAAACTTTGTAGAGTCAGTTCAAGCTATATCAGGAGAAACTATTGAT
TTTGATATCCCATATCGTGAATTAGGATTCCATGGTGTACCTTATAGGTCTAATGTTTTC
ATTATGCCATCAGTTAATTGTCTTGTTAGTCTTATAGATCAACCATTTTTTGTTATTAGT
CTAAGCGATATAGAAGTAGCACATTTTGAACGAGTCCAGTTTACATTAAAAAACTTTGAT
TTAGTCCTTATTTTTAAAGATTATTCTATTACACCAATCAGAATCTGCACAATTCCAGCA
GAGTTTTTAGAATCAATTAAAGACTGGCTTAATGATATTGATATTGTTTATTCAGAAAGT
TTAAACCCTTTGAATTGGGGAAATGTTATGAAAGAAATCACTAGGGATTTGCAAGGGTTT
ATTGAAGAAGGAGGTTGGGATTTCTTACAAGAAAGTGATAATGAAGGGGAGTCTGGGCAA
AGTGATGATGAATTAGAAGTTGATTCTGAGTTTAATGAAGAAGATGTTGGGTCAGAATTT
GAAGATGATGAGAGTGAGTTTAGTGATGAAAGTGAAGAAGAAAATGATGATGAGTCTGAA
GCTGATTTTGATAGTGAAGATGAGTCTGGGCTTGAATGGGATGAACTTGAAGCTCAAGCT
AAGAAAATGGACGCGAAGAAAAACCCGAAAGTCATTAAAGAAGTCAAGCCTTCAAACAAA
AGAACTAAAAAATAG