Identifiers and Description

Gene Model Identifier

SteCoe_18800

Standard Name

None

Aliases

None

Description

histidine kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005320402.1151310375910805e-19ATPase, histidine kinase-, DNA
gyrase B-, and HSP90-like dom
ain containing protein. Sequen
ce similarity to the HisK prot
ein kinase family (Eisen et al
., 2006)."
Oxytricha TrifallaxContig12483.0.g435.74952226429356e-19Histidine kinase-, DNA gyrase
B-, and HSP90-like ATPase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18800(Protein)
MNIASSNSHISLWKLLKHSYSSSLKHYFLVTLVLVIELFLSYFIYNSSAYSKTLLLLSIL
ANTLGIQHFSMDKDLPSVISFKHLLLISLNLHENSAEKLSTIISLFQFIGLIVIADDLIR
CRLEFESQDKKLTQSLELVNIFFDDTDSHCAVLDQKFNFIRKSRCFDILFREVDFSLIEY
VPKLSPELKRNVKNDINGLFDSVKGTGKLETVNIHGIRYLYEARTISYNNQPAVLLRLKN
ANSEALLEKEVQEGKMKSELLRTVTHELRTPVNSIMNMISLASNDSIPNGNTEKLNIAYS
SCQYLLCIINDLLDYSQIKAGCLRITKSSFLLKAFIKDVIDLVRCQAGVKSLTIINKSHD
SVPETVYSDPFRLKQILLNLLSNSIKFTSSGYIELSITRCGKTLKFSCKDTGIGIKPDKL
NTLFSMFAFDDDTKDLNPQGVGLGLYISNILAIQLGSSSIQVESILGKGSEFSFAIDYLN
NELHNSYIEDIPEEVCDIHLPDSSPPQNLSNKTKFVRKKTLRSSTQIINTNVVLIADDSS
FNIMVFNQLLQKEGILTNAVYNGDEAVKEIIKHDGRYECILLDCEMPVMNGWEVARKLKE
YKRLGMIKNLPIIIGTTAYCDESIMASCTNAGMDDVIIKPCVREELILKIHYWVKMYRMN
LL


>SteCoe_18800(CDS)
ATGAACATAGCCTCCTCAAATTCGCATATAAGTCTATGGAAACTGCTAAAGCATTCTTAC
TCCAGCTCATTGAAACATTATTTTTTAGTGACTCTAGTCCTGGTGATCGAGCTTTTTCTA
AGCTATTTTATATACAATTCAAGTGCCTATTCGAAAACCTTACTATTGTTAAGTATTTTA
GCAAACACCTTAGGAATACAACACTTTTCTATGGACAAAGATCTCCCATCAGTAATTTCT
TTCAAGCATTTACTCCTCATTTCCTTGAATCTTCATGAAAACTCAGCAGAAAAGCTTAGC
ACCATAATATCTTTATTTCAATTTATCGGGCTTATTGTAATTGCTGATGATCTTATAAGG
TGTAGACTTGAATTCGAGAGCCAAGATAAAAAGCTAACTCAGAGTCTAGAATTAGTTAAC
ATATTTTTTGACGATACTGATTCACATTGCGCTGTTTTGGATCAGAAATTTAATTTTATA
CGTAAAAGTCGTTGTTTTGATATACTTTTTAGAGAAGTAGATTTTTCTCTTATTGAATAT
GTGCCGAAGTTATCCCCTGAATTAAAAAGGAATGTTAAAAATGATATTAATGGGCTTTTT
GATAGTGTTAAAGGCACAGGGAAATTAGAAACTGTGAATATTCATGGGATAAGATATTTA
TATGAAGCTAGGACTATAAGTTATAATAACCAGCCAGCTGTGCTTTTGAGACTTAAAAAT
GCGAATTCGGAGGCTTTGCTTGAAAAAGAAGTCCAGGAAGGCAAAATGAAGTCTGAGCTT
TTAAGAACTGTAACTCACGAATTACGAACGCCAGTAAACTCAATAATGAATATGATTTCA
CTGGCTTCTAACGACAGCATACCAAATGGGAATACAGAAAAACTTAACATTGCATACTCT
TCTTGCCAATACCTTTTATGCATAATAAACGACCTCTTAGACTATTCACAAATAAAAGCA
GGGTGTTTAAGAATAACCAAATCAAGTTTCCTTTTAAAAGCTTTTATCAAAGATGTTATT
GATCTAGTTCGTTGCCAAGCTGGTGTGAAATCTTTAACAATAATAAACAAGTCCCACGAT
TCAGTCCCAGAAACAGTTTATTCTGACCCATTCCGTCTAAAACAAATCCTCCTAAACCTT
CTTAGCAACTCTATAAAATTCACATCAAGTGGTTACATAGAACTCTCTATAACCAGATGT
GGTAAAACCTTAAAATTCTCCTGTAAAGATACAGGTATCGGTATTAAACCAGATAAACTT
AACACCCTCTTTTCTATGTTTGCTTTTGATGATGATACAAAAGATCTAAATCCTCAAGGT
GTAGGTCTTGGTCTTTATATATCAAATATTCTTGCTATACAACTTGGTTCCTCAAGTATC
CAAGTTGAAAGTATTCTTGGTAAAGGTTCAGAATTTAGTTTTGCTATTGATTATCTAAAT
AACGAACTTCATAATAGTTATATTGAAGATATCCCTGAAGAAGTTTGCGATATACACTTA
CCAGACTCTTCACCACCACAAAATCTGTCTAATAAAACCAAATTTGTTCGTAAAAAAACC
TTAAGAAGTAGTACACAAATTATAAATACAAATGTTGTCCTAATAGCCGATGATAGTTCT
TTCAATATTATGGTTTTTAATCAGTTATTACAAAAAGAAGGGATATTAACTAATGCGGTT
TATAATGGAGATGAAGCTGTTAAAGAAATTATAAAACATGATGGAAGATATGAATGCATT
TTATTGGATTGTGAAATGCCCGTTATGAATGGATGGGAAGTTGCGAGGAAATTGAAAGAG
TATAAGAGGTTGGGGATGATTAAGAATTTACCGATTATTATTGGAACGACAGCGTATTGT
GATGAGAGTATTATGGCTAGTTGTACGAATGCTGGGATGGATGATGTGATTATTAAACCT
TGTGTTAGAGAAGAATTGATATTGAAAATTCATTATTGGGTGAAGATGTACCGTATGAAT
CTTTTATAA