Identifiers and Description

Gene Model Identifier

SteCoe_18840

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9742.0.g621.9287498479639178e-22RNA recognition motif. (a.k.a.
RRM, RBD, or RNP domain)

WormBaseWBGene000091415.242885663363464e-22
Saccharomyces CerevisiaeYPL178W2.1151310375910805e-19Small subunit of the heterodim
eric cap binding complex with
Sto1p; interacts with Npl3p, p
ossibly to package mRNA for ex
port from the nucleus; may hav
e a role in telomere maintenan
ce; contains an RNA-binding mo
tif
Tetrahymena ThermophilaTTHERM_004717305.74952226429356e-19nuclear cap binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18840(Protein)
MAAYLYESPNPDSEYIDRQQGYGTEEYKEKLRESSTLYIGNLSNYTKEEQIYELFSLCGK
VKRVVMGLDRYKKTPCGFCFVEYYTHSAAANAINCLNSTQLENRIIRADWDIGFKEGRQY
GRGRGGGQKRDSVRNDNESHRDDEAADGEDVGNKRKRRN


>SteCoe_18840(CDS)
ATGGCAGCCTATTTATACGAAAGCCCAAACCCAGACTCTGAGTATATAGACAGACAGCAA
GGTTATGGGACTGAAGAGTATAAGGAAAAGCTCAGAGAATCCTCAACGCTTTATATAGGA
AACTTGTCTAACTATACCAAAGAAGAGCAGATTTACGAGCTTTTTTCTCTTTGTGGAAAA
GTGAAAAGAGTAGTAATGGGCCTGGATCGGTATAAAAAAACTCCTTGTGGATTTTGTTTT
GTTGAATATTATACACATTCAGCAGCTGCTAATGCGATAAATTGTCTTAATTCAACTCAG
CTTGAAAATCGAATTATAAGAGCTGATTGGGATATTGGGTTTAAAGAAGGTAGACAATAT
GGACGAGGCCGTGGCGGTGGACAAAAACGTGACTCAGTTAGGAATGATAATGAGTCACAT
CGTGATGACGAGGCAGCTGATGGAGAAGATGTGGGAAATAAACGTAAGCGAAGAAACTAA