Identifiers and Description

Gene Model Identifier

SteCoe_18847

Standard Name

None

Aliases

None

Description

MCM_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14518.0.0.g1150hypothetical protein

WormBaseWBGene000031550
Saccharomyces CerevisiaeYEL032W1.3485799642996046e-77Protein involved in DNA replic
ation; component of the Mcm2-7
hexameric helicase complex th
at binds chromatin as a part o
f the pre-replicative complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18847(Protein)
MDQVTIDAMKTRVETETLNLLQGDEYRGKINDMIANEQSRLLINLDDLRKRPNDISKDIL
DYPTILIKGIEDALNNAVRVEMEGPKKTMKRYHVSFEGNFGTHYITPRGLKSNLTNKLVK
VQGIVTRMSIVRPKLIFSQHYCEETKKFTEKAYGDSYEVSTLQAGSNAIPTHDLNGKPYS
FEFGLSSYKDHQSLTIQELPERAPTGQLPRSVEIIVEEDLVDKVKPGDRIEIVGVYKSVN
SASMSSYGLLKTMIIGSNIYSISAELALPNLTGKDISLIKKFSQSANIITLLANSFSPSI
FGHEQIKKALILLLLSGEEKNLENGTHLRGDINIMLIGDPSTAKSQLLRSVLNIAPLATS
TTGRGASGVGLTAAVTSDKDTGERNLEAGAMVLADRGVICIDEFDKMNEVDRVAIHEVME
QQTVTIAKAGIHTSLNARCSVVAAANPLYGTYMRDKSPAWNIALPDSLLSRFDLLFIVLD
HKLPELDRLIASRVIHNHCSVAFAVTDDMDIDTPVIEPLPPQEEDEEQKPATFNFEGKEM
FTRTFLKKFLHYAKQTIHPVLTNDSSDFISQAWSSLRSKEEEAGRHRVVSITVRTLETMI
RLSTAIAKAHLSTTVKKVHCEEALKLMKFAIFQEEDSPQIPTPEVEMADVLSSLGTRSSR
RRQRKEDESRKVAEVVESAKRVSTRVTQDHKKFVFKAVVDKLRDLPNPTMKVADLWKIIQ
KSKDHKIEDQNHLIDVIKALDVEGKFAYQEKEKNIILIL


>SteCoe_18847(CDS)
ATGGACCAAGTGACAATAGACGCAATGAAAACTCGTGTAGAAACCGAAACTCTAAATCTA
TTGCAAGGAGATGAATACCGAGGTAAAATTAACGATATGATTGCAAACGAACAGTCTCGG
CTGCTCATAAATCTTGATGACCTAAGAAAGCGACCTAATGACATATCAAAAGACATTCTT
GACTACCCAACAATACTAATCAAAGGTATTGAAGATGCTTTAAACAATGCTGTCCGAGTA
GAAATGGAAGGACCTAAAAAGACCATGAAGCGCTATCATGTGAGCTTTGAAGGGAATTTT
GGTACTCATTACATAACCCCAAGAGGTCTGAAATCAAATTTAACTAATAAATTAGTCAAA
GTCCAAGGTATTGTCACACGTATGAGCATCGTTAGACCTAAATTGATATTTTCTCAGCAT
TATTGTGAAGAAACGAAAAAGTTCACAGAAAAAGCTTATGGGGATAGCTATGAAGTGTCA
ACATTACAGGCGGGAAGCAATGCTATACCGACCCATGACCTTAATGGTAAGCCTTATAGC
TTTGAATTCGGTTTAAGCTCATATAAAGATCATCAATCACTAACTATTCAAGAACTACCA
GAAAGAGCTCCAACAGGACAATTACCAAGATCTGTTGAAATTATTGTAGAAGAAGATCTT
GTAGACAAAGTGAAACCTGGTGACCGGATTGAGATTGTTGGAGTTTATAAAAGCGTTAAC
TCAGCTTCTATGAGTTCATATGGTTTGCTTAAAACAATGATTATAGGTAGCAACATTTAC
TCTATTAGCGCTGAATTAGCATTACCCAACTTAACAGGTAAAGACATTTCTTTAATAAAA
AAATTCAGCCAAAGCGCAAATATTATAACCTTACTCGCTAATTCTTTCAGTCCTTCGATT
TTTGGCCATGAGCAGATAAAAAAAGCTTTAATTCTCCTTCTTTTAAGTGGTGAAGAGAAA
AACCTTGAAAATGGGACTCATTTAAGAGGAGATATAAACATAATGCTTATAGGTGACCCA
TCAACAGCAAAATCCCAACTTTTAAGAAGTGTTTTAAATATAGCCCCATTAGCTACAAGT
ACAACAGGTCGTGGAGCTTCAGGTGTAGGTTTAACAGCAGCAGTTACTAGTGATAAAGAT
ACAGGTGAAAGAAATCTTGAAGCTGGGGCAATGGTTTTAGCTGATAGAGGGGTTATTTGT
ATAGATGAATTTGATAAAATGAATGAAGTAGATCGAGTTGCTATACATGAAGTTATGGAG
CAACAAACAGTAACAATAGCAAAAGCTGGAATTCATACAAGTCTAAACGCAAGATGTAGT
GTCGTAGCTGCAGCTAATCCTCTTTATGGAACTTATATGAGAGATAAAAGCCCAGCATGG
AATATCGCTTTACCTGATTCATTATTATCAAGATTTGATTTATTATTCATAGTACTTGAT
CATAAATTGCCTGAATTAGATAGATTGATAGCTTCAAGAGTTATTCACAATCATTGTAGT
GTAGCTTTTGCTGTTACTGATGATATGGATATTGACACTCCAGTTATTGAACCACTTCCA
CCACAAGAAGAAGATGAAGAACAGAAACCAGCAACTTTTAATTTTGAAGGCAAAGAAATG
TTTACAAGGACATTTCTTAAAAAATTCTTACATTATGCTAAACAAACAATACACCCAGTT
TTGACAAATGATAGTAGTGATTTTATATCACAAGCATGGTCAAGTCTTAGAAGTAAAGAA
GAAGAAGCAGGAAGGCATAGGGTTGTTTCAATAACTGTTAGAACACTTGAAACTATGATT
AGATTGTCAACGGCTATAGCTAAAGCACATTTATCTACTACTGTTAAGAAAGTTCATTGT
GAAGAAGCTTTGAAACTTATGAAATTTGCTATTTTCCAAGAAGAAGATAGTCCACAAATA
CCTACACCTGAAGTTGAAATGGCTGATGTTTTATCATCGTTAGGGACTAGAAGCTCAAGA
AGAAGGCAAAGGAAGGAGGATGAAAGTAGAAAAGTTGCTGAGGTTGTTGAAAGTGCTAAA
AGAGTATCGACAAGGGTTACTCAGGATCATAAGAAATTTGTGTTTAAGGCTGTTGTGGAT
AAACTTAGGGACTTGCCTAATCCGACTATGAAAGTTGCGGATTTGTGGAAGATTATACAG
AAGAGTAAGGATCATAAGATTGAGGATCAGAACCATTTGATTGATGTCATTAAAGCTTTG
GATGTTGAAGGGAAGTTCGCTTATCAGGAAAAAGAAAAGAATATCATTTTAATTCTTTAG