Identifiers and Description

Gene Model Identifier

SteCoe_18976

Standard Name

None

Aliases

None

Description

PARG_cat domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000520401.5628821893349888e-181-evidence-related
Oxytricha TrifallaxContig12363.0.g648.533047625744066e-17Poly (ADP-ribose) glycohydrola
se (PARG)

WormBaseWBGene000040520.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_18976(Protein)
MYQSYKDFLNFNSQEWKYTCNLLQDFNSESFDDFCNVISQLQCNNWQEPIRSILTEYCPY
QNEIVKHFNWVKEKILRLPELFPNGLEPYYNESIIKLDKNRCLGILGALFFSCSQRMHTF
LDERESAKFQCMISYFNIMKSLSDDDLNNEFFIIEKKSLSPDNQSAWLKDDHILLDYEIY
EELKIEDYNYKSIKADFANQYIGGGVLSFGCVQEEILFSIYPELLISMVFCKPMKPHEAI
VLKGARRAANYSGYAWNFRFVEQCSQDIPKDQNGCIENTFVAMDALMSPSLLAQFSEDCL
WRELNKAFISFNRNSFDCQEQLDPVVTGRWGCGEFGGFAPLKILLQWISASSAGRKIVVT
TFKDRTLGELAEIMEKFRGTKCRELLEMIIKSPDCELLSILLGKKAFEERPPFVIPSGKD
LLGRFGKKD


>SteCoe_18976(CDS)
ATGTACCAAAGCTATAAGGATTTTCTTAATTTCAATAGCCAAGAATGGAAATACACATGC
AATTTATTACAGGACTTTAACAGCGAGTCTTTTGATGATTTTTGCAATGTTATATCACAA
TTACAGTGTAATAATTGGCAAGAACCAATTAGAAGTATTCTTACTGAGTATTGTCCTTAT
CAAAATGAAATAGTTAAGCATTTTAACTGGGTTAAAGAAAAAATACTTAGGCTTCCTGAA
TTGTTCCCTAACGGATTAGAACCGTATTACAATGAGTCGATAATAAAACTTGACAAAAAC
AGATGCTTAGGGATCCTCGGTGCTCTATTTTTTTCCTGCAGCCAAAGAATGCACACTTTT
CTTGACGAAAGGGAATCAGCAAAATTTCAATGTATGATAAGTTATTTCAACATAATGAAA
TCTTTATCAGATGATGATTTAAACAACGAATTTTTCATCATCGAAAAAAAATCCTTATCA
CCCGATAATCAAAGTGCATGGCTTAAAGATGATCATATTTTACTAGATTACGAAATCTAT
GAAGAGCTTAAAATTGAAGACTATAACTACAAATCCATAAAAGCTGATTTTGCTAATCAA
TACATTGGAGGAGGAGTCTTATCTTTTGGATGTGTCCAAGAAGAAATTCTTTTTTCAATA
TACCCTGAGTTACTTATATCAATGGTATTTTGTAAACCTATGAAACCTCATGAAGCTATA
GTCCTTAAAGGGGCAAGAAGAGCTGCTAATTATTCAGGTTATGCTTGGAATTTTAGATTT
GTTGAACAATGTTCTCAAGATATTCCTAAAGATCAAAATGGATGTATTGAAAATACTTTT
GTCGCTATGGATGCTTTAATGAGTCCATCATTATTAGCTCAATTTAGTGAAGATTGTTTA
TGGAGAGAATTGAATAAAGCTTTTATATCTTTTAATAGAAATAGCTTTGATTGTCAAGAA
CAACTTGATCCTGTTGTTACTGGAAGGTGGGGATGTGGGGAATTTGGTGGTTTTGCCCCT
TTGAAAATACTTTTACAATGGATTTCAGCAAGTTCTGCTGGGAGAAAAATTGTAGTGACT
ACTTTTAAAGATAGGACTCTTGGGGAATTAGCTGAGATTATGGAAAAGTTTAGAGGGACT
AAATGTAGGGAACTTTTGGAAATGATTATTAAAAGTCCTGATTGTGAATTGTTGAGTATT
TTGCTTGGGAAGAAGGCTTTTGAAGAAAGACCTCCGTTTGTTATCCCCTCTGGAAAAGAT
TTACTTGGGAGATTTGGAAAGAAGGATTAG