Identifiers and Description

Gene Model Identifier

SteCoe_19005

Standard Name

None

Aliases

None

Description

Peptidase_M8 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_0000869661.1677812485237086e-60leishmanolysin family protein
Oxytricha TrifallaxContig18862.0.g773.1391327920480296e-17hypothetical protein

WormBaseWBGene000127960.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19005(Protein)
MRSIFILIFLSTALVNSWKCGGDRTEVQEQSGHGRFLTTRSATLSPIRILYYYQNFALLS
QTDTDNFKNIIMPDIDSYLTKALKVYSITSSLSLGGTTCGSEITVPSEHQNPGVTGYDLI
VYITSVYDSSSDYVAYAGACFIDGTLNNVVAGRVVVNTYYFDGADFEMMYSTLLHEITHL
LGFSSGLYSYWRDSKGLAYTQPTKNITIRGTTKIVLTTPNALAKAVEAFNCSTMTGVELE
EYGGSGTAGSHWDMRIMFNEYMIGHVTSDPYVSTVSLGLLKDTGWYDVDYSYATIPAFAK
NSGCGFINNKCVASGVSADRNLWCDANNNDVCDTFRLNKGYCVLNTYTTSLPSYYQYFSD
PKVGGWDSYADYCPVKYPWSNGSCRGNSQTTYTYSLADEVISMKSRCFESTLDQSPYVST
SIYLACYEVISCSNTSAVIQVGSTAITCPFIGGNVTVPGYNGVLICPNSDILCRDVPCKN
MCSGFGKCAMGQCLCASGYSGDDCTIKCSDSCVSCLDSTTCLNCTTGYSLVSGSCVAGCT
SLCTSCTNNVCSACTTGYYLSSGACIACSPGCTVCTSATQCTNCLTDYVLTNGICTLQCP
SNCKNCVSSSLCIACNTSFYIDSLGGCSPCSTGCTTCISDTVCSVCASGYLLSNSACNLA
CSTSCITCSSNLCTKCKYGYYLSSGFCVACSPNCATCTSTTACTACNSGYNLVSSACASV
CPLNCKSCTGTTCTDCFSNYYVTSGTCTACPNNCTSCTSTSCLSCSAGYALVNGACTKMC
PINCATCNTSGSCTACAPGYYITTGTCTSCAAGCSVCTATTCSSCLPGYKLSGTTCQPIC
SLGCKTCSSSSSCTVCLSGYYLLSSSCVACSSGCSVCTSTACTTCISGYILSGNTCVQGC
QNVCKTCTSGVCSDCDPGFYLSNNVCVACSKGCTQCNSDTSCTVCGAGYLLSDSACISSC
PVNCKTCDSTGKCTECLSGSFLSNNACTSCSSGCSTCTSATVCTVCTAGLSLSGTSCKSD
CSPFCVSCTSPTVCTKCSTGYLLSSNACTNCPASCNNCTTVTGSDALSCTLCKSGYILSS
GTCIKACPPNCIACDANGACQTCLPGYFIASGACSNCSTGCSTCTSNTACTACSVGYKLN
DNKACIVACPPSCLVCGATGTCTTCQSGFYVASGTCKACTSNCATCTSTACTTCDVGYNI
VSGLCSMQCPAYCQNCIDPQTCTKCRPGYFLSSGSCQPCSNGCNSCTSASVCTLCNAGYM
LSSNSCTAICTANCAVCSSGSCSDCLPGYYLSGGLCVACQASCSKCTSSTACTICNPGYY
ISSAGLCTINCPANCKTCGSTGTCTACYSGYFLPTTGGCTACSQGCAVCTSATVCTTCNA
GFALTGSTCTPTCPVNCNICTSTACTQCNPGFYIDNGSCTACGANCGNCTSSTVCSACTK
GYLLTSTNTCGPACSTNCLACSSASTCTLCANGYFISNGACTACSANCASCTSATVCTAC
NPGYGVTSTSSCAALCQTVCATCTTGTCSKCINGFFLSSGTCKACSNNCSTCTSATVCTA
CNSNFALSSGSCV


>SteCoe_19005(CDS)
ATGCGGAGTATATTCATTCTAATATTCCTCTCAACAGCCTTAGTGAATTCCTGGAAATGT
GGAGGAGACCGAACAGAAGTTCAAGAACAGTCTGGCCATGGACGCTTCCTGACAACTCGT
TCAGCAACCTTGTCTCCCATTCGAATTCTTTACTATTACCAAAACTTCGCTTTACTTAGT
CAAACAGATACGGATAATTTTAAGAACATAATCATGCCTGATATCGACAGTTATTTAACC
AAAGCTCTTAAAGTTTATTCAATAACATCATCTCTTTCATTAGGTGGGACAACTTGTGGA
AGTGAAATTACAGTTCCTAGTGAGCATCAAAATCCAGGTGTCACAGGTTATGATTTGATA
GTTTATATAACATCAGTATATGATAGTTCTAGTGATTATGTAGCATATGCTGGTGCTTGT
TTTATTGATGGAACTCTTAATAATGTTGTTGCTGGAAGAGTTGTTGTTAATACATATTAT
TTTGATGGTGCTGATTTTGAAATGATGTATTCAACACTTCTTCATGAAATAACTCATTTA
CTTGGGTTTTCAAGTGGACTTTATAGCTATTGGCGTGATAGTAAAGGTCTTGCATATACT
CAACCAACAAAAAATATTACAATTAGAGGTACAACAAAAATTGTCTTAACTACTCCTAAT
GCTCTTGCTAAAGCTGTTGAAGCTTTTAATTGCTCAACAATGACTGGTGTTGAACTTGAA
GAATATGGAGGAAGTGGTACTGCTGGATCTCATTGGGATATGAGAATAATGTTTAATGAA
TATATGATTGGTCACGTTACATCTGATCCATATGTCAGTACAGTATCATTAGGTTTACTT
AAAGATACAGGATGGTATGATGTAGATTACTCTTATGCTACAATTCCAGCTTTTGCTAAG
AACTCAGGTTGTGGGTTTATCAATAACAAATGTGTGGCAAGTGGAGTGTCTGCTGATCGT
AACCTTTGGTGTGATGCTAATAATAATGATGTGTGTGATACATTCCGTTTAAATAAAGGT
TATTGTGTTTTAAATACATATACCACATCTTTACCATCATATTATCAATACTTTTCAGAT
CCAAAAGTTGGAGGATGGGATTCATATGCAGATTATTGCCCTGTTAAATACCCTTGGTCT
AATGGTAGTTGTCGTGGGAACAGTCAAACTACTTATACATATTCTTTAGCTGATGAAGTT
ATAAGTATGAAAAGTAGATGTTTTGAAAGCACATTAGATCAATCACCTTATGTATCAACA
TCAATATATCTTGCTTGTTATGAAGTGATTAGTTGCTCTAATACTTCTGCTGTTATTCAA
GTTGGATCAACTGCAATTACTTGTCCTTTTATTGGTGGAAATGTTACAGTCCCAGGATAT
AATGGAGTATTAATATGTCCTAATTCTGATATATTATGTCGTGATGTTCCATGCAAAAAC
ATGTGCTCAGGGTTTGGGAAATGTGCTATGGGACAATGTTTATGTGCATCTGGGTATTCA
GGAGATGATTGCACAATAAAATGCTCGGATAGTTGTGTTTCATGTTTGGATTCTACTACT
TGTTTAAATTGTACAACTGGATATTCACTTGTATCGGGTTCGTGTGTTGCTGGATGCACT
TCTTTATGTACTTCATGCACAAACAACGTTTGCAGCGCTTGCACAACTGGATATTATTTG
TCATCAGGTGCATGCATAGCTTGTTCTCCTGGATGTACAGTTTGTACTTCAGCAACCCAA
TGTACCAATTGCCTAACAGACTATGTTTTAACCAACGGAATATGTACACTTCAATGTCCT
AGTAACTGTAAAAACTGTGTAAGTAGCTCATTATGTATAGCTTGTAACACTTCTTTTTAT
ATCGATTCATTAGGTGGTTGCTCACCATGTTCAACTGGTTGTACAACTTGTATATCTGAT
ACTGTTTGCTCTGTATGTGCTAGTGGATATTTACTTTCAAATTCTGCTTGTAATTTAGCA
TGTTCAACTTCTTGTATAACATGTAGTTCAAATTTATGTACAAAGTGCAAATACGGATAC
TATCTTTCTAGTGGCTTTTGTGTAGCCTGCTCACCAAATTGTGCTACTTGTACATCAACA
ACAGCTTGCACAGCATGTAATTCTGGATATAACCTTGTCAGTAGTGCATGTGCTTCAGTA
TGCCCATTAAACTGTAAATCCTGTACTGGGACAACATGTACAGATTGTTTTTCAAACTAC
TATGTTACTTCAGGTACCTGTACAGCATGTCCTAATAACTGTACATCATGTACAAGTACA
TCTTGTCTATCTTGTTCAGCCGGTTATGCATTAGTCAATGGAGCATGTACGAAAATGTGC
CCGATAAACTGTGCTACATGCAACACTTCTGGAAGTTGTACAGCTTGTGCACCAGGGTAT
TACATAACTACAGGTACTTGTACATCTTGTGCTGCTGGATGCTCTGTTTGCACTGCAACA
ACTTGTTCATCTTGTCTTCCAGGATATAAACTATCAGGGACAACTTGTCAGCCAATATGT
TCATTAGGATGTAAAACATGTTCAAGTTCTTCATCTTGTACTGTATGTTTATCAGGATAC
TATTTGTTGTCTAGTTCATGTGTTGCTTGTTCATCTGGATGCTCAGTGTGCACAAGTACA
GCATGTACAACATGCATATCAGGGTATATATTATCAGGGAATACATGTGTACAAGGTTGC
CAAAATGTATGCAAAACTTGCACAAGTGGGGTTTGTTCAGATTGCGATCCTGGTTTCTAC
CTATCAAATAATGTATGTGTAGCTTGTTCTAAAGGATGTACTCAATGTAATAGTGATACT
TCATGTACAGTTTGTGGTGCAGGGTATTTACTTTCTGATTCTGCATGTATTTCCTCTTGC
CCTGTAAATTGCAAAACTTGTGACAGTACTGGAAAATGCACAGAATGCTTAAGTGGGAGC
TTTTTAAGCAACAATGCATGTACTTCTTGTAGCTCAGGGTGCTCAACATGTACTTCAGCA
ACTGTATGTACAGTTTGTACTGCTGGACTTTCTCTAAGTGGCACATCATGTAAATCTGAC
TGTTCACCATTTTGTGTATCTTGTACCAGCCCAACAGTCTGTACAAAATGCAGCACTGGT
TATTTACTATCCTCAAATGCTTGTACAAATTGTCCAGCTTCTTGTAATAACTGCACAACA
GTTACCGGTTCAGATGCTTTATCATGTACTCTATGTAAATCAGGTTATATTTTAAGTAGT
GGTACTTGTATTAAAGCTTGTCCACCAAATTGTATAGCTTGTGATGCAAATGGGGCATGT
CAAACTTGTCTTCCTGGATATTTTATAGCATCAGGGGCTTGTTCAAATTGTTCAACTGGA
TGCTCAACTTGTACTTCAAATACTGCATGTACAGCATGTAGTGTTGGGTATAAACTTAAT
GATAATAAAGCATGTATTGTTGCTTGTCCACCTAGTTGTTTAGTATGTGGAGCAACAGGG
ACCTGCACAACATGCCAAAGCGGTTTCTATGTTGCTAGTGGCACTTGCAAAGCTTGTACT
TCTAATTGTGCTACATGTACTTCAACTGCATGTACAACTTGTGATGTTGGGTACAATATA
GTAAGTGGTCTATGTTCTATGCAATGCCCAGCTTATTGCCAAAACTGTATTGATCCTCAA
ACATGCACAAAATGCCGTCCTGGTTATTTCCTATCTTCAGGATCATGTCAACCTTGTTCA
AATGGTTGTAATAGTTGTACATCTGCATCGGTATGCACTTTATGTAATGCAGGTTATATG
TTAAGTTCTAATAGTTGTACTGCTATATGCACAGCTAATTGTGCTGTTTGCTCATCAGGA
TCTTGTTCTGACTGCTTACCAGGTTATTATCTTTCTGGTGGATTATGTGTTGCATGTCAA
GCTTCATGTTCTAAATGCACAAGTTCAACTGCATGCACAATTTGTAACCCAGGATATTAT
ATCAGCTCTGCAGGATTATGCACAATAAATTGCCCTGCAAACTGTAAAACCTGTGGTTCA
ACAGGTACTTGTACAGCATGTTATAGTGGCTATTTCTTACCAACTACTGGAGGATGTACT
GCTTGTTCACAAGGATGTGCAGTTTGTACATCAGCCACAGTTTGCACAACATGTAATGCT
GGTTTTGCCCTTACTGGAAGTACATGTACACCAACATGTCCTGTTAATTGTAACATTTGT
ACTTCTACAGCTTGCACACAATGTAACCCTGGATTTTATATTGATAATGGTTCTTGTACA
GCCTGTGGGGCCAATTGTGGGAATTGTACTAGTTCAACTGTTTGTAGTGCTTGCACTAAA
GGATATTTATTGACAAGTACTAATACTTGTGGACCTGCTTGTTCTACTAATTGTCTGGCT
TGTTCAAGTGCTTCAACATGCACACTATGCGCTAATGGCTACTTTATTTCAAATGGTGCT
TGTACTGCATGTTCTGCAAATTGTGCATCGTGCACTTCTGCTACTGTTTGTACTGCTTGC
AATCCAGGATATGGTGTAACAAGTACATCATCATGTGCTGCCTTATGTCAAACAGTTTGT
GCAACCTGCACTACAGGTACTTGTTCTAAATGCATTAATGGTTTCTTTTTAAGTAGTGGA
ACCTGTAAAGCTTGTTCAAACAACTGCAGTACATGCACAAGTGCTACTGTTTGCACAGCT
TGCAATTCTAATTTCGCATTAAGTTCAGGAAGCTGTGTCTAA