Identifiers and Description

Gene Model Identifier

SteCoe_19045

Standard Name

None

Aliases

None

Description

RNase_T domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYOL080C1.1548224173015786e-17Putative RNA exonuclease; poss
ibly involved in pre-rRNA proc
essing and ribosome assembly
Tetrahymena ThermophilaTTHERM_000088000.000000000000001713908431542013exonuclease family protein
Oxytricha TrifallaxContig15694.0.g120.0000000000006914400106940203Exonuclease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19045(Protein)
MDSEKKDMLKVLKSLSSPQLPKKRLIKESNLDKNWKKNSLYKSLSINNESYVAVDCEMIS
TENDKNKLARVSIVNMEGDVLLDIYVKPDEKVLNYRTFVTGIKARHLNTGKPFKEVRKMV
KNIIRNKIVVGHAIHHDLNALKLDLPKDKIRDTQALYSETAGVSSISLQKLCQQTLSRII
QTGQHSSVEDAWATMEIFKTLFLANKTKKSKNIHKKPKIEKHTTFNDKDN


>SteCoe_19045(CDS)
ATGGACTCAGAGAAAAAAGACATGCTAAAAGTCTTAAAATCTCTGAGTTCACCACAGTTA
CCAAAGAAAAGACTAATAAAAGAATCAAACTTGGATAAAAACTGGAAAAAAAACTCTTTA
TACAAGTCTCTTAGTATAAACAATGAAAGTTATGTTGCTGTAGATTGTGAAATGATTAGT
ACAGAAAATGATAAAAATAAACTAGCCAGAGTGAGTATAGTTAATATGGAAGGTGATGTT
TTACTTGATATTTATGTAAAACCTGATGAAAAAGTATTGAACTATAGAACTTTTGTCACA
GGGATCAAAGCTAGGCATTTAAATACAGGGAAACCTTTTAAAGAAGTTCGTAAAATGGTT
AAGAATATTATAAGGAATAAAATTGTTGTTGGACATGCTATTCACCATGACCTCAATGCT
TTAAAGCTTGATTTACCTAAAGATAAAATCAGAGATACCCAAGCTTTATATTCAGAAACT
GCTGGAGTTAGTAGCATATCTTTACAAAAATTATGTCAACAAACACTAAGTAGGATAATA
CAAACAGGACAACATTCATCAGTAGAAGATGCTTGGGCTACAATGGAAATATTTAAAACC
CTTTTCCTAGCTAACAAAACCAAAAAGTCTAAAAACATACATAAAAAGCCTAAAATCGAA
AAGCATACAACTTTTAATGATAAAGATAATTGA