Identifiers and Description

Gene Model Identifier

SteCoe_19283

Standard Name

None

Aliases

None

Description

UQ_con domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006705903.532628572200807e-24ubiquitin-conjugating enzyme E
2 variant 2
Saccharomyces CerevisiaeYGL087C7.095474162284704e-23Ubiquitin-conjugating enzyme v
ariant; involved in error-free
postreplication repair; forms
a heteromeric complex with Ub
c13p, an active ubiquitin-conj
ugating enzyme; cooperates wit
h chromatin-associated RING fi
nger proteins, Rad18p and Rad5
p; protein abundance increases
in response to DNA replicatio
n stress
Oxytricha TrifallaxContig716.0.g253.873997628687187e-21Ubiquitin-conjugating enzyme

WormBaseWBGene000067305.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19283(Protein)
MHAQVPRNFRLLDELEKGEKGLGDPNVSYGLERGDDNTLSNWMGMIQGPPGGSHEGRLYS
VSIHCGPNYPQEAPRVRFVCRINMNCVNQNNGNVDPHAFRIIGNWNPTYSMETILVELRK
EMNSAANKRLPQPPEGSNY


>SteCoe_19283(CDS)
ATGCATGCTCAAGTTCCTAGGAATTTCCGTCTATTGGATGAATTAGAGAAAGGTGAAAAA
GGACTAGGCGATCCAAATGTGAGTTATGGTCTAGAACGAGGTGATGACAATACTCTAAGT
AACTGGATGGGCATGATTCAAGGTCCACCTGGAGGAAGCCACGAAGGTCGTTTATATTCT
GTTAGCATACACTGTGGACCCAATTACCCTCAAGAAGCTCCTCGTGTGAGGTTCGTGTGC
AGAATCAATATGAACTGCGTGAACCAAAATAATGGTAATGTAGACCCCCATGCATTCAGA
ATAATTGGCAACTGGAACCCAACGTACTCCATGGAAACCATCTTAGTGGAGCTCAGAAAA
GAAATGAATTCTGCTGCTAATAAAAGATTACCGCAGCCACCTGAAGGATCGAACTATTAA