Identifiers and Description

Gene Model Identifier

SteCoe_19343

Standard Name

None

Aliases

None

Description

Rad60-SLD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18025.0.g120.000000000000001713908431542013Ubiquitin-2 like Rad60 SUMO-li
ke

Tetrahymena ThermophilaTTHERM_004101300.000000000000004658886145103398small ubiquitin-related modifi
er (SUMO), conjugated to lysin
e residues on target proteins,
post-translational modificati
on,

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19343(Protein)
MSNPDLVEGSSEHITLKVKSQDGNEVFFKIKRATQLKKLMEAYCSRNGVNISTVRFLFDG
QRIQETNTPNDLHLEENDQIDAMVEQTGGI


>SteCoe_19343(CDS)
ATGTCTAATCCTGATCTAGTTGAAGGTTCATCAGAACATATTACGCTTAAAGTCAAATCT
CAAGATGGAAATGAAGTGTTTTTTAAGATCAAACGTGCTACACAACTCAAGAAATTAATG
GAAGCTTATTGCTCTAGAAATGGTGTTAACATAAGCACAGTAAGATTTTTATTTGATGGA
CAGAGGATTCAAGAAACAAACACTCCCAATGACCTCCATTTAGAAGAAAATGATCAAATA
GATGCAATGGTTGAACAGACTGGAGGAATTTAA