Identifiers and Description

Gene Model Identifier

SteCoe_19350

Standard Name

None

Aliases

None

Description

Tyr-DNA_phospho domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18880.0.g201.2995814250075031e-24Tyrosyl-DNA phosphodiesterase

Tetrahymena ThermophilaTTHERM_005373202.1151310375910805e-19Tyrosyl-DNA phosphodiesterase
family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19350(Protein)
MESQQKIPDTDTPEEIKKSTTTQNEENLKKRKRDENEKEEERKNPIFTTGTSIFITPLNF
IYPKPENILTIRQILYEDLKDIPNRPKTLQGALLTTFALEMEFIMPIVTAGFKVCIVSHG
KPERVEKISDNFTVVYPKVQQWGSFHPKLFILKFPYRLRIVITSANLVGCDWNLIGQCIW
FQDFFYGDDPDAGFLKDLKKFVDDIIPKKTEILKELGIDLDRYNFRNSAVDLITSVPGKY
RIPCDYGFEKINQFVKKKYSHFTYQCSSVGALTGTLKKDICKSFTNNPNCEIDIIFPCFR
NVMESHLGTPGAGVFFMKENSYKNEDFLHKNLCSMEGPTESFSGHLSHSKVLIIHDNYEI
NDETLIYIGSHNLSGAAWGKYEKNNTQLSISNYEAGIIFKSQPDSKDLKKYIISQLPFKF
PPSKYLRDDRPFFIDTDMGK


>SteCoe_19350(CDS)
ATGGAAAGTCAACAAAAAATTCCTGATACAGATACCCCTGAAGAAATAAAAAAATCCACC
ACCACACAAAACGAAGAAAATCTAAAAAAACGAAAACGCGATGAAAACGAAAAAGAAGAA
GAAAGAAAAAATCCAATCTTCACAACTGGTACAAGTATTTTTATAACACCTTTAAATTTC
ATATACCCAAAACCAGAAAATATTCTTACAATAAGACAAATATTATATGAAGACTTAAAA
GATATTCCAAATAGACCAAAAACTTTACAAGGTGCATTATTAACAACTTTTGCTTTAGAA
ATGGAATTTATAATGCCAATTGTCACTGCTGGATTTAAAGTTTGTATTGTTTCTCATGGG
AAACCTGAGAGAGTAGAAAAAATATCAGATAATTTTACTGTTGTTTATCCTAAAGTCCAA
CAATGGGGAAGTTTCCATCCTAAATTATTTATCCTAAAATTCCCATATAGATTAAGAATT
GTTATAACAAGTGCTAATTTAGTAGGCTGTGATTGGAATTTAATAGGTCAATGCATTTGG
TTTCAAGATTTTTTTTATGGAGATGATCCAGATGCAGGGTTTTTAAAAGATCTTAAAAAA
TTTGTTGATGATATTATCCCTAAGAAAACTGAAATTCTTAAAGAACTTGGTATAGATCTT
GATAGATATAATTTTAGAAACTCAGCTGTTGATTTAATCACTTCTGTTCCAGGAAAATAT
AGGATTCCTTGTGATTATGGGTTTGAAAAGATTAATCAATTTGTGAAAAAAAAATATTCG
CATTTCACATATCAATGTAGTAGTGTTGGAGCTTTAACTGGGACATTGAAAAAAGATATC
TGTAAAAGTTTTACTAATAATCCTAATTGTGAAATAGATATTATATTTCCATGCTTCCGA
AATGTTATGGAGTCACATCTTGGCACACCTGGAGCGGGTGTATTCTTTATGAAAGAAAAC
TCATATAAAAATGAAGACTTTCTTCATAAAAACCTTTGCAGTATGGAAGGTCCAACTGAA
TCTTTTTCAGGCCATCTAAGCCATAGTAAAGTTCTTATAATTCATGACAATTATGAAATA
AACGATGAGACTCTTATATATATAGGAAGTCATAACCTATCTGGAGCTGCTTGGGGAAAA
TATGAGAAAAATAATACACAGTTATCTATATCAAATTATGAAGCTGGCATTATTTTTAAA
TCTCAACCTGATTCTAAAGATCTTAAAAAATATATTATCTCTCAACTTCCTTTCAAATTC
CCCCCAAGTAAATATCTTCGTGATGATAGACCGTTTTTTATTGATACTGATATGGGTAAA
TAG