Identifiers and Description

Gene Model Identifier

SteCoe_19388

Standard Name

None

Aliases

None

Description

Dynamin_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYKR001C8.074506789675094e-73Dynamin-like GTPase required f
or vacuolar sorting; also invo
lved in actin cytoskeleton org
anization, endocytosis, late G
olgi-retention of some protein
s, regulation of peroxisome bi
ogenesis
Oxytricha TrifallaxContig17275.0.g479.710436457780846e-67Dynamin central region

Tetrahymena ThermophilaTTHERM_002183202.138865964899539e-62Dynamin central region family
protein; localized to subcorti
cal mitochondria
WormBaseWBGene000010932.138865964899539e-62

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19388(Protein)
MDKLIPVINRLQDALGTIHTKVNLELPQIVVVGAQSSGKSSVLESIVGKDFLPRGSGIVT
RRPLVLHLTQTHTNDEWGEFTHMPGKKFKDFDKIRHEIEAETERLLGKKANISNESIFLR
IYSPNVLDVTLVDLPGLTKVPVGDQPIDIEAQIRRMILDFITNPNSIILAISNANQDLAN
SDSLKLAREVDPTGDRTLGVITKIDLMDKGTDAMEMLKGKLYPLKLGYVGVMCRSQADIN
ANKLIKKHIEDEKKFFMTHEKYRVIAHSMGIPHLSWKLNKLLMHHIKAVLPDLKKKVSEM
IRSNEEQLRTYGFPLSENRDLQGVVMLNVITSYATSFSNAVEGKTLTEAGTELEGGAKIR
DILLRKFIQHLKNMDALNSMDDSDIKNIIDSSCGVMSSLLIPEAAFNMLLKMQIKRLLDP
SQTVIMEVYDQLKILSSDIIIPEAVRFPNLQPAILSVVDNVLEDCLKPAQDFINDFIEIQ
QAYVNSFHPDCINVREALHRAEKDVEEIDPSMHNSTLLLDKSREFDSWGKTDARFETSED
EKNELIQVYTIRHLLTSYFDVIKKNVGDYVSKAVMSFLVIKVRDKIQTDLISKLYNNEKF
NELFAENSDIPFKRKALEDQMIGLNIASKILSEVRDFDLEHN


>SteCoe_19388(CDS)
ATGGATAAACTTATTCCAGTAATAAATCGCTTACAAGACGCTTTGGGGACAATTCATACA
AAAGTAAACCTTGAATTACCTCAAATTGTCGTAGTTGGAGCTCAGTCATCAGGTAAATCA
TCAGTCCTTGAAAGTATTGTTGGTAAAGATTTTCTTCCACGTGGTAGTGGTATAGTAACA
AGGCGTCCTTTAGTTCTGCATTTAACACAGACACATACAAATGATGAATGGGGAGAATTC
ACTCATATGCCAGGGAAGAAATTTAAAGACTTTGACAAAATAAGACATGAAATAGAAGCT
GAAACAGAAAGATTACTTGGAAAAAAAGCAAATATATCAAATGAAAGTATTTTTTTAAGA
ATATATTCACCTAATGTTCTTGATGTTACTTTAGTAGATTTACCTGGATTAACAAAAGTT
CCAGTAGGGGATCAACCAATAGATATTGAAGCTCAAATACGAAGGATGATTTTAGATTTT
ATTACAAACCCTAATTCTATAATATTAGCTATTTCAAATGCTAATCAAGATCTTGCGAAT
TCTGATTCATTAAAACTTGCTAGAGAAGTTGACCCAACTGGAGATAGAACTTTAGGAGTT
ATTACAAAAATTGATTTGATGGATAAAGGTACAGATGCAATGGAGATGCTTAAAGGAAAA
TTATATCCTTTAAAACTTGGTTATGTTGGGGTTATGTGTAGAAGTCAAGCAGATATAAAT
GCTAATAAGTTGATAAAAAAACATATTGAAGATGAGAAAAAATTCTTTATGACACATGAG
AAATATCGAGTTATTGCTCATTCTATGGGTATTCCACATCTTTCTTGGAAGTTAAATAAA
CTACTTATGCATCATATTAAAGCTGTACTTCCGGATTTGAAGAAAAAAGTTAGTGAGATG
ATTCGGTCTAATGAAGAACAATTAAGAACATATGGGTTTCCTTTATCAGAAAATAGAGAT
CTTCAAGGAGTTGTTATGTTGAATGTTATAACTTCATATGCTACTAGTTTTAGTAATGCT
GTTGAAGGGAAAACTCTTACAGAAGCTGGGACTGAGCTTGAAGGTGGGGCTAAAATAAGG
GATATTTTATTAAGGAAATTTATTCAACACTTGAAAAATATGGATGCTCTTAATAGTATG
GATGATAGTGATATTAAAAATATTATAGACAGTTCTTGTGGGGTTATGTCATCATTACTT
ATCCCTGAAGCAGCTTTTAATATGCTTCTTAAAATGCAAATTAAAAGACTTTTAGACCCT
TCTCAGACTGTTATAATGGAAGTTTATGATCAATTAAAAATCTTAAGTTCGGATATCATC
ATCCCTGAAGCTGTACGTTTTCCAAATCTTCAGCCAGCGATTTTATCTGTAGTTGACAAT
GTTCTTGAAGACTGTCTTAAGCCTGCACAAGATTTTATTAATGATTTTATAGAAATCCAA
CAGGCATATGTTAATTCTTTTCACCCTGACTGTATAAATGTAAGAGAAGCGCTTCATAGA
GCAGAAAAAGATGTTGAAGAAATAGATCCTTCTATGCATAATTCAACTCTTTTACTTGAT
AAAAGTAGAGAATTTGATTCTTGGGGAAAAACTGATGCTCGTTTTGAAACCTCAGAAGAT
GAAAAAAATGAACTTATTCAGGTTTATACAATAAGACATTTACTTACATCTTATTTTGAT
GTTATTAAAAAGAATGTTGGAGACTATGTATCAAAAGCAGTTATGAGTTTTTTAGTTATT
AAAGTTCGAGATAAAATTCAAACTGATTTGATATCGAAATTATATAATAATGAGAAGTTT
AATGAACTGTTTGCGGAAAATTCTGATATTCCATTTAAGAGAAAAGCATTAGAAGATCAG
ATGATTGGGCTTAATATTGCATCGAAAATTCTTTCGGAAGTTAGAGATTTTGATTTGGAG
CATAATTAA