Identifiers and Description

Gene Model Identifier

SteCoe_19439

Standard Name

None

Aliases

None

Description

SNF2_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002374901.9503933001302485e-65SNF2 family N-terminal domain
containing protein
WormBaseWBGene000042984.7111658015535965e-58
Saccharomyces CerevisiaeYGL163C9.462629465836378e-57DNA-dependent ATPase that stim
ulates strand exchange; modifi
es the topology of double-stra
nded DNA; involved in the reco
mbinational repair of double-s
trand breaks in DNA during veg
etative growth and meiosis; me
mber of the SWI/SNF family of
DNA translocases; forms nuclea
r foci upon DNA replication st
ress
Oxytricha TrifallaxContig13957.0.g35.900090541597061e-29SNF2 family N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19439(Protein)
MNYIKGGTSENKLTSKFKPPFSNQPSNFRPGKLMSLMCNPMNQILKKNNDFSKPANLLDF
PIENTPDIKLNPKEDNQISDNEKTLWKNHEDKDSLYKNNTDEVRGNEDKEQKGFKNIEDG
TKNALHKSFKPPFSKICNEVHEKKGLQDALKPAIPIIKSENLEKNNLNTLKDPNPNENTD
LPNNLVCFDKDNTISTSCKLPNPPNSNNFQSSDLQLPIKNQENKPNETTTVIEKSEHQHD
ENKLPIPPLVPKKKLTSFVFHPLNPNIKTNPPAQTEDKTLNEIYYEVIYSHKHKKKGKSE
DGVLVLSLKKMLLIDTTGKQISETPNNLRAKCFRDGEEIDIGTRKVIVQKKIPRLEYISG
RCFIAQTVQPVEIPKVYKPIVKEVIVPDGAFVIDEEQKVYVEPFLAEKLRPHQKEGVQFM
YDCIAGKRKEGYFGCILADSMGLGKTLQAITLLYTILRKDATYPTFASKGIIVSPATLVD
NWRDEVLKWLGPYKMSPIVCSGSGKQKKNLLTIFESGPSPLLIISYESFVKYSKTMKNIC
NVIICDEGHLLKNCVTQKNCAISMMNCKRRILLTGTPLQNYLSEFYACVTLVNPGILGDP
TTFNRLYADPILRAQEPNANNTIRDLAWGRSEELWRVTAQFILRRTGSILESVLPPRNEF
LVFCKCLPLQRDVYSALLSSRLFSLALEGGSAANALALTSILRKLVNHPDLVYLSKYSNP
EIEASVKKTLKFFPADYIKDVDRTKHSTKLKFFDIIMTQCIEKNEKLVVVSCYTKTLDLI
EQHCRYKEYGFLRLDGSTLTKNRMQLVTSFNNSPNPLAFLLSTKAGGCGLNLIGANRLIL
YDPDWNPSSDKQAMGRIWRDGQKKSVFIYRLFLSGTIEEKIYQRQTAKENLSSTVVDAKK
AVSKFSKEDLKEIFSLTNFCTSIENGDCSTEEESLLGLMKDFIDLHKKVKADWETVKMEK
LDFTEAQQENVETEKCIELTKSSAKKKSQKEKNN


>SteCoe_19439(CDS)
ATGAATTACATAAAAGGCGGTACATCTGAAAACAAGCTAACAAGTAAATTCAAACCCCCA
TTCTCAAATCAACCATCTAACTTTCGTCCAGGGAAACTAATGTCACTTATGTGTAATCCT
ATGAACCAGATTCTTAAGAAAAACAATGATTTTTCAAAACCTGCAAATCTTTTGGATTTC
CCAATAGAAAATACTCCTGATATAAAATTAAACCCAAAAGAAGACAATCAAATATCAGAT
AATGAAAAAACACTATGGAAAAATCATGAAGATAAAGATTCTTTATATAAAAATAATACT
GATGAAGTAAGGGGAAATGAAGATAAAGAGCAGAAAGGATTTAAAAATATAGAGGATGGG
ACGAAAAATGCTTTACATAAGTCTTTTAAGCCACCTTTTTCGAAGATATGCAATGAAGTG
CATGAGAAAAAGGGCTTGCAAGATGCGCTGAAGCCTGCAATCCCAATAATTAAAAGCGAA
AATTTAGAAAAAAATAACTTGAATACGCTAAAAGACCCAAACCCAAATGAAAACACTGAT
TTGCCAAACAATTTAGTATGCTTTGATAAAGATAATACCATATCTACATCTTGCAAATTG
CCTAACCCCCCAAATAGCAACAATTTTCAAAGCTCAGACCTACAACTTCCTATAAAAAAT
CAAGAAAACAAGCCTAATGAAACCACAACAGTTATAGAAAAATCTGAACATCAGCATGAT
GAAAACAAACTTCCTATACCACCATTAGTTCCAAAAAAAAAACTTACTTCATTTGTCTTC
CATCCACTAAACCCCAACATAAAAACCAATCCCCCTGCCCAAACTGAAGACAAAACTTTA
AACGAGATTTATTACGAAGTTATTTACTCACATAAACATAAGAAAAAAGGTAAATCAGAA
GATGGAGTTCTAGTCTTAAGCTTGAAAAAAATGCTGTTAATAGACACAACTGGTAAGCAG
ATATCTGAAACTCCTAATAATCTTAGGGCAAAATGTTTTCGAGATGGCGAGGAAATCGAT
ATTGGGACTCGAAAAGTTATTGTTCAAAAGAAAATCCCAAGACTTGAATACATATCCGGA
AGATGTTTCATAGCTCAAACAGTTCAACCTGTAGAAATCCCCAAAGTCTATAAACCTATA
GTAAAAGAAGTGATAGTTCCTGATGGAGCTTTTGTTATAGACGAAGAACAAAAAGTATAT
GTCGAACCTTTTCTAGCAGAAAAACTCAGACCACATCAAAAAGAAGGTGTTCAATTCATG
TATGACTGTATTGCCGGTAAACGTAAAGAAGGATATTTCGGCTGCATATTAGCAGATTCT
ATGGGATTAGGTAAAACCTTACAAGCAATAACTTTATTATATACCATTTTACGTAAAGAT
GCAACTTACCCAACTTTTGCTAGTAAAGGTATTATAGTCTCACCAGCCACATTAGTTGAT
AACTGGAGAGATGAAGTTTTAAAATGGTTAGGCCCTTATAAAATGTCTCCAATTGTATGC
TCAGGTTCAGGTAAACAAAAAAAGAATCTTTTAACTATATTTGAAAGTGGTCCTTCACCT
TTGCTTATAATCAGTTATGAATCATTTGTCAAGTATTCAAAAACTATGAAAAATATTTGT
AATGTTATAATATGTGATGAAGGGCACTTATTAAAAAACTGTGTGACTCAAAAAAATTGT
GCTATTAGTATGATGAACTGTAAAAGACGTATACTCCTTACTGGGACACCTTTGCAGAAT
TATTTATCTGAGTTTTATGCTTGTGTAACTTTAGTCAATCCTGGGATTTTAGGTGACCCG
ACTACGTTTAATAGATTATATGCGGACCCAATACTTAGAGCTCAAGAACCCAATGCGAAT
AATACAATTAGAGACTTGGCTTGGGGTAGATCTGAAGAATTATGGAGAGTCACTGCGCAG
TTTATATTAAGGCGTACAGGGTCGATACTTGAGTCAGTCCTCCCTCCACGTAATGAGTTT
TTGGTTTTCTGTAAATGTTTACCTTTGCAAAGAGATGTTTACTCTGCACTTCTGTCTTCT
AGGCTTTTTTCCTTAGCACTTGAAGGGGGAAGTGCAGCAAATGCTTTAGCTTTGACGTCG
ATTCTAAGAAAACTTGTCAATCATCCTGATTTAGTGTATTTAAGCAAGTATAGCAATCCT
GAAATAGAAGCTTCAGTTAAAAAAACCCTTAAGTTTTTCCCTGCAGATTATATAAAAGAT
GTTGATCGGACCAAACACTCAACTAAACTCAAGTTTTTTGACATAATCATGACCCAGTGT
ATTGAAAAAAATGAAAAACTTGTTGTTGTGTCTTGCTATACAAAAACCTTAGACCTTATA
GAGCAACATTGTCGATATAAAGAATATGGGTTTTTACGTTTGGATGGGTCAACACTTACC
AAAAACAGAATGCAACTGGTCACATCTTTTAACAACTCCCCAAACCCATTAGCTTTTCTT
CTAAGCACTAAAGCTGGTGGCTGTGGGCTAAATCTTATTGGGGCAAATCGGCTTATTTTA
TATGACCCAGACTGGAATCCTAGTAGTGACAAGCAAGCTATGGGCCGTATATGGCGTGAC
GGGCAAAAGAAGTCTGTGTTTATTTATAGGCTTTTTTTAAGTGGGACTATTGAGGAAAAA
ATTTACCAGAGACAAACTGCAAAAGAGAATTTATCGTCAACAGTTGTTGATGCTAAAAAA
GCTGTGAGTAAATTCTCGAAAGAAGATTTGAAGGAAATTTTTAGCTTGACGAACTTTTGC
ACTAGTATAGAAAATGGGGATTGCTCAACTGAGGAAGAATCATTGTTAGGACTTATGAAG
GATTTTATTGATTTACATAAAAAAGTTAAAGCAGACTGGGAGACTGTTAAGATGGAGAAA
CTTGATTTTACTGAAGCACAACAAGAAAATGTTGAAACTGAAAAATGTATTGAGTTGACA
AAAAGCTCAGCGAAGAAGAAAAGTCAAAAGGAAAAAAATAATTAA