Identifiers and Description

Gene Model Identifier

SteCoe_1951

Standard Name

None

Aliases

None

Description

CAMKK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003848801.603810890548638e-28Protein kinase domain containi
ng protein. Sequence similarit
y to a protein kinase family u
nique to Tetrahymena thermophi
la (Eisen et al., 2006)."
Oxytricha TrifallaxContig14736.0.g1178.75651076269652e-27Protein kinase domain

WormBaseWBGene000005183.873997628687187e-21
Saccharomyces CerevisiaeYKL166C2.3195228302435696e-16cAMP-dependent protein kinase
catalytic subunit; promotes ve
getative growth in response to
nutrients via the Ras-cAMP si
gnaling pathway; partially red
undant with Tpk1p and Tpk2p; l
ocalizes to P-bodies during st
ationary phase; TPK3 has a par
alog, TPK1, that arose from th
e whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1951(Protein)
MGFCCSKSIKIASTSKKDDQITLPMTTLMPYSSQASLRIAPNHIKTRSSSPPKTLTKFDL
PTPQGTKTCNTISPISVKKTQNLFEVAKSKPISSQTMKSVSTIDLDLIKKAKRFSLIISK
NPNTDLDLSDNSESDEISIGSESPNTPLKFPNHCNTQTEMPKNISFKSLKTMNDVIHTQS
LTKQRSLEGQKKINQYTFKGLLGTGAFGKVYKVIDDQGNPAAVKVYNKKTLRNRWIGKKR
TAWDLIQSEIQIMSSLNHKGIIRLLEVIDFKESKKIYLVLEYIEKGSIFDKCPMTEKEAK
NYFYDLVLAIEYLHNTAYVVHRDIKPQNLLITKDNHIKICDFGSAQFIDNLRDELNNSAG
TYLFMPPEAHKAKGFRGKPADIWALGITLYYMIAGRTPFNSRNISSLCDEISQEEIMFTQ
NFSDKVKSLIRGMTDKDPEKRYSIDAVKEHLWFKDVIL


>SteCoe_1951(CDS)
ATGGGATTCTGTTGTTCAAAAAGCATTAAAATAGCCAGCACATCAAAAAAAGATGATCAA
ATAACTTTACCTATGACAACACTAATGCCATATTCTTCACAAGCATCATTAAGAATAGCT
CCAAATCATATCAAAACTAGATCTTCAAGTCCACCAAAAACCCTAACAAAGTTCGATCTC
CCAACACCCCAAGGAACAAAAACATGTAATACCATCTCCCCAATATCAGTAAAAAAAACC
CAAAACTTATTCGAAGTTGCTAAATCAAAGCCTATCTCATCTCAAACAATGAAATCAGTA
TCAACTATCGACCTTGATCTAATCAAAAAAGCTAAGCGTTTTTCTCTAATTATATCAAAA
AACCCAAATACCGACCTTGACCTTTCTGATAATTCTGAAAGCGACGAAATCTCAATTGGA
AGCGAATCGCCAAATACACCTTTAAAGTTCCCAAATCATTGCAACACTCAAACCGAAATG
CCAAAAAATATATCTTTTAAATCATTAAAAACTATGAATGATGTTATCCATACCCAATCT
TTAACAAAACAACGATCTTTAGAAGGACAAAAGAAAATAAATCAATACACATTCAAAGGA
CTATTAGGAACTGGTGCTTTTGGTAAAGTGTATAAAGTAATTGATGATCAAGGTAACCCT
GCAGCAGTTAAGGTTTATAATAAGAAAACTCTTAGAAACAGATGGATTGGGAAAAAAAGG
ACAGCTTGGGATTTAATCCAAAGTGAAATCCAAATCATGTCAAGTTTAAACCATAAAGGA
ATCATACGACTTTTAGAAGTTATCGACTTTAAAGAAAGTAAAAAAATCTACCTAGTTCTT
GAATATATAGAAAAAGGGTCGATTTTCGATAAATGTCCTATGACTGAAAAAGAAGCTAAA
AATTATTTTTATGATCTTGTTTTAGCTATTGAATATCTACACAATACAGCTTATGTTGTT
CATAGAGATATTAAGCCTCAAAATTTACTTATTACTAAAGATAATCATATAAAAATTTGT
GATTTTGGATCTGCACAGTTTATTGATAATTTAAGAGATGAACTAAACAATTCAGCTGGA
ACATATTTGTTTATGCCTCCAGAAGCACATAAAGCTAAAGGGTTTAGAGGAAAACCTGCT
GATATTTGGGCTTTAGGAATTACTTTGTATTATATGATTGCTGGAAGGACACCATTTAAT
AGTAGAAATATATCAAGTTTATGTGATGAGATTAGTCAAGAAGAGATTATGTTTACTCAG
AATTTTAGTGATAAAGTTAAGAGTTTGATTAGAGGAATGACTGATAAAGATCCTGAAAAA
AGGTATAGCATTGATGCTGTTAAAGAACATTTATGGTTTAAAGATGTAATTTTATAA