Identifiers and Description

Gene Model Identifier

SteCoe_19630

Standard Name

None

Aliases

None

Description

DSPc domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • protein tyrosine/serine/threonine phosphatase activity (IEA) | GO:0008138

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004211604.0795586671775603e-41hypothetical protein
Oxytricha TrifallaxContig10505.0.g608.985825944049381e-37C2 domain of PTEN tumour-suppr
essor protein

WormBaseWBGene000009132.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19630(Protein)
MNIIRKIVSGKKNRLDEDGFNLDLTYITPRIIAMSLPGMGVHKMYRNSIDSVSEFLNKRH
HGCYRIFNLSGLKYNYDKFGGSVKEYPWEDHHPPPIDLLFEACGDIHKWLDLNESNIIAV
NCLAGKGRTGTLICCYLMYSGRLHNPYQALNYYKNKRFYQGGGVTQPSQVRYVHYFSQVL
FSGIRSPNILQLKSLRILTAPHNSQDSCRLIFELRQHNRIVFSNKKSSRDKQPVLSDNWK
NIITHEIATINNELFLQGDVHCYLYHWGALKMKKICRFSFSTAFISPGSTIVFNKQELDP
DSFRESKNVSEDFSVFVEFDKKKCECLSNLMISERCDGCEIFFDPLEKQKWLNIQNILLE
RVRVNPSKMLFGYEVDDIDEELSPGFIKNEE


>SteCoe_19630(CDS)
ATGAACATCATTAGAAAGATAGTATCAGGGAAGAAAAATCGTCTTGATGAAGACGGGTTC
AATCTAGACTTAACATATATAACCCCAAGGATAATTGCGATGTCTTTGCCAGGAATGGGA
GTACACAAAATGTATCGAAACTCAATAGACTCAGTATCAGAGTTCCTAAACAAGCGTCAC
CATGGATGTTACCGTATCTTCAACCTTAGCGGCCTAAAGTATAACTACGACAAATTTGGA
GGTAGCGTAAAAGAGTACCCATGGGAAGACCATCACCCACCTCCAATCGATTTGCTTTTT
GAGGCATGTGGGGATATACACAAATGGTTAGATCTAAATGAAAGCAACATAATCGCCGTA
AACTGTCTCGCAGGTAAAGGTCGTACAGGAACATTAATCTGTTGTTATCTCATGTACTCT
GGTCGTTTACACAATCCATATCAAGCTTTAAACTACTATAAAAACAAACGTTTCTATCAA
GGAGGTGGAGTAACCCAACCATCTCAAGTTCGATACGTTCATTATTTCTCTCAAGTTCTC
TTTAGTGGTATCCGTTCTCCAAACATTCTCCAACTTAAATCCTTAAGAATTCTCACGGCA
CCACACAATTCTCAAGATTCCTGTAGGTTAATATTTGAACTTCGTCAACATAATCGTATT
GTATTTTCTAATAAAAAATCCAGTAGAGACAAACAACCTGTTTTAAGTGATAATTGGAAA
AACATAATAACCCATGAAATCGCCACAATTAATAATGAACTTTTCCTTCAAGGTGATGTA
CACTGTTATTTATATCATTGGGGTGCTTTAAAAATGAAGAAAATCTGCAGATTTTCTTTT
AGTACAGCTTTTATATCCCCAGGTTCAACTATTGTATTTAATAAACAAGAATTAGACCCT
GATAGTTTTCGTGAAAGCAAAAACGTTTCTGAAGATTTTTCAGTGTTTGTCGAGTTTGAT
AAGAAAAAATGTGAATGTTTGAGTAATTTAATGATATCAGAACGTTGTGATGGATGCGAA
ATTTTTTTCGACCCTTTAGAAAAGCAAAAATGGCTGAATATACAAAATATTTTGCTTGAA
AGGGTTAGGGTAAATCCATCAAAAATGCTTTTTGGCTATGAAGTTGATGATATTGATGAG
GAATTGAGTCCTGGGTTTATAAAAAATGAAGAATAA