Identifiers and Description

Gene Model Identifier

SteCoe_19683

Standard Name

None

Aliases

None

Description

SNF2_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000372109.462629465836378e-57SNF2 family N-terminal domain
containing protein
Saccharomyces CerevisiaeYLR032W1.368539471173853e-44DNA helicase/Ubiquitin ligase;
involved in error-free branch
of DNA damage tolerance (DDT)
pathway; proposed to promote
replication fork regression du
ring postreplication repair by
template switching; stimulate
s synthesis of free and PCNA-b
ound polyubiquitin chains by U
bc13p-Mms2p; required for erro
r-prone translesion synthesis;
forms nuclear foci upon DNA r
eplication stress; associates
with native telomeres, coopera
tes with homologous recombinat
ion in senescent cells
WormBaseWBGene000100611.0806392777072785e-30
Oxytricha TrifallaxContig21260.0.g594.248354255291589e-18SNF2 family N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19683(Protein)
MENSNFQIFAEITKEKNEKVYMKFIELGRGKLEKAIEMFFSQAKNNSLMAEIDLKRKVPS
EEEKVGNIKLGSFITEAVSLRSLMQIPACKMMYYKFNRAVKSKKNETTEKSIRFSLEKDA
FSVAKLNYLTSELLYPLINGDLILLEINTITELNINTLDTFQVMITVTMRPDLFSNPSAK
MNEEAAAKNIPTTEYCNQRESFSKLIQLINIKKTQSALINKNSTQKNNDIQPSQEMSEDE
KSQCLKHFEEKSIPLTKPVNSFKSILFPYQAQALTWMLERETQTRSSKTSSQLHHLWEEY
TLENEKKIYINSCTGQISLSFPQAGELCKGGILADEMGLGKTVMMISLIHTSRKPLRNTS
KKVKKSNEGGTLIILPLSLISQWKSEFDTHGEGISVLEYYTEKSRNMSELISADVILTTY
GVFCSESSSKGYLTQISWFRVILDEAHTIRNRNTSTAKAVFKIQAEHKWALTGTPIQNTI
DDLYSLIRFLEMEPWSDYTWWNRIITHKFLKKNSECFSILQRLLKPIMLRRTKDSKQENG
QPIVVLPNLNIHDVKLKLENDEKYVYDKLFSLSKAKYTLLVREGKIKTHVTCIFELLLRL
RQYCDHPYLVMSRGDVKSSESLEDFINKYANDENNGYLEGLLEKLKNGVESDCPVCLETC
DDPVMTKCAHVLCRTCATQQIEKNRNCPLCKTQLGICDLTTIPRDSKFSFDIESEYKSSA
KIDFLLTLLNETENNTVVFTQWITMLDILEITMKRENISYSRLDGSMSKQQRENNLQSFK
SGKRVLLVSLKSGGQGLNLICASQVVLFDPWWNPAVEHQAIERVHRIGQRKEVNAYRLVT
QNTVEEKIVEMQNRKEKMIEGAFSDKVCSLNLETLRDIFQGL


>SteCoe_19683(CDS)
ATGGAAAACTCGAACTTTCAGATATTTGCTGAAATTACTAAGGAAAAAAACGAAAAGGTG
TATATGAAATTTATAGAACTAGGTCGGGGGAAGTTGGAAAAAGCTATAGAGATGTTTTTT
AGCCAGGCTAAAAACAACAGTTTGATGGCCGAAATAGATTTAAAGAGAAAAGTTCCTTCT
GAAGAAGAGAAGGTAGGAAATATAAAACTAGGTAGTTTTATTACTGAAGCTGTATCACTA
AGAAGTTTAATGCAAATACCTGCTTGTAAAATGATGTACTATAAATTCAACCGAGCTGTG
AAATCAAAAAAAAACGAGACTACAGAAAAATCCATACGTTTTTCTTTAGAAAAAGACGCT
TTCTCAGTTGCTAAGCTCAATTACTTAACAAGTGAGTTACTTTACCCACTTATCAATGGA
GATTTGATTTTATTAGAAATCAACACAATTACAGAACTTAATATCAACACTTTAGATACC
TTCCAAGTCATGATTACCGTAACTATGAGACCTGATCTTTTTAGTAACCCATCAGCCAAG
ATGAACGAAGAAGCTGCAGCAAAAAACATCCCTACTACTGAATACTGCAATCAAAGGGAG
TCTTTTTCTAAGCTAATCCAACTTATCAACATAAAAAAAACTCAAAGCGCGCTAATAAAT
AAAAACTCAACACAAAAAAACAACGACATCCAACCATCCCAAGAAATGAGTGAAGATGAG
AAATCCCAATGTTTAAAACACTTTGAAGAAAAATCAATCCCCCTAACAAAACCAGTCAAT
TCCTTCAAATCTATACTTTTCCCATATCAAGCTCAAGCTTTAACATGGATGCTTGAAAGG
GAAACTCAAACACGTAGTTCTAAAACCTCATCCCAACTTCATCATTTATGGGAAGAATAT
ACATTAGAAAATGAGAAAAAAATCTATATCAATTCTTGTACAGGGCAAATATCATTATCA
TTTCCTCAAGCTGGCGAGTTATGCAAAGGAGGTATTCTCGCAGATGAAATGGGATTAGGT
AAAACAGTCATGATGATATCTTTAATCCACACAAGCCGAAAACCTTTAAGAAACACATCA
AAAAAAGTTAAAAAATCTAATGAAGGTGGTACATTAATAATCCTTCCACTTTCTCTTATA
AGCCAATGGAAAAGTGAATTTGACACTCATGGTGAAGGAATATCAGTACTTGAGTATTAT
ACAGAAAAATCAAGAAATATGTCTGAACTCATTAGCGCTGATGTAATACTAACAACTTAT
GGGGTATTTTGTTCAGAATCTTCAAGTAAAGGTTATTTAACTCAAATATCATGGTTCAGA
GTAATATTAGATGAAGCTCATACAATAAGAAATAGAAACACTTCAACAGCTAAAGCGGTA
TTTAAAATCCAAGCTGAACATAAATGGGCTTTAACAGGTACACCAATACAAAATACTATA
GATGATTTATACTCTTTAATTCGATTTTTAGAAATGGAACCATGGAGTGATTATACTTGG
TGGAATCGAATAATAACACATAAGTTCTTAAAAAAAAACTCTGAGTGTTTTTCTATACTA
CAAAGACTTTTAAAACCAATAATGCTTAGAAGGACCAAAGATAGCAAGCAAGAAAATGGT
CAACCGATAGTCGTATTGCCAAATCTTAATATCCATGATGTGAAATTAAAACTAGAAAAC
GATGAAAAATATGTTTACGATAAGCTTTTTAGTTTATCAAAAGCAAAATATACATTATTA
GTAAGAGAAGGGAAGATTAAAACTCATGTGACGTGTATTTTTGAGTTATTACTTAGATTA
AGACAATATTGTGACCATCCTTATTTAGTCATGAGCCGCGGAGATGTGAAATCTTCTGAG
AGTCTTGAGGATTTTATAAACAAATACGCAAACGATGAGAATAATGGGTATTTAGAAGGT
CTGTTAGAAAAACTAAAAAATGGGGTTGAGTCTGATTGCCCAGTATGTTTAGAAACATGT
GATGATCCGGTCATGACAAAATGCGCTCATGTTTTATGTAGGACCTGCGCTACTCAACAA
ATAGAAAAAAATCGTAATTGCCCTTTATGTAAAACCCAACTTGGTATATGCGATTTAACA
ACTATACCAAGGGATTCTAAATTCAGCTTTGATATTGAATCTGAATATAAATCTTCAGCT
AAAATCGACTTTCTCTTAACTTTACTTAATGAAACCGAAAACAATACTGTGGTTTTTACA
CAATGGATTACTATGTTAGATATATTAGAAATTACTATGAAAAGAGAAAATATATCATAT
TCTAGACTTGATGGAAGTATGTCTAAACAACAACGTGAAAATAACCTTCAAAGTTTTAAA
AGTGGTAAAAGAGTTTTACTTGTATCTTTAAAATCAGGAGGACAAGGGCTTAATTTAATA
TGTGCAAGTCAAGTTGTGCTTTTTGACCCTTGGTGGAATCCTGCTGTTGAACATCAAGCT
ATAGAACGTGTACATAGAATAGGCCAAAGAAAAGAAGTTAATGCTTATAGACTAGTAACT
CAAAATACAGTTGAAGAAAAAATCGTAGAAATGCAAAACCGTAAGGAAAAAATGATAGAA
GGGGCATTTTCTGATAAAGTTTGTTCATTAAATCTTGAAACCTTACGGGATATTTTCCAA
GGGCTTTAA