Identifiers and Description

Gene Model Identifier

SteCoe_19728

Standard Name

None

Aliases

None

Description

DUF1899 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3627.0.g265.5210822770285325e-42Domain of unknown function (DU
F1900)

Saccharomyces CerevisiaeYLR429W3.0144087850653746e-40Coronin; cortical actin cytosk
eletal component that associat
es with the Arp2p/Arp3p comple
x to regulate its activity; pl
ays a role in regulation of ac
tin patch assembly
Tetrahymena ThermophilaTTHERM_002933803.3057006267607343e-37hypothetical protein
WormBaseWBGene000007681.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19728(Protein)
MVSIVRQSKYRHVFGEELKVKFEEVKSTALASEGTLVVSNGKYSAFCWETAGPGTLAVVA
QSEAGRIPPNHPWIKGHTANISDFEFNPYNDNEIVTGCDDSLIRLWRLSGDRIHEEINTP
LTTLQGHSRKISVLNFHPAAAYVLASASHDKTIKVWNMERAQEVLSYGGITDNVFSLMWS
PHGKSLAFTARDKYARGIDPRSNRPSFEFLAHDGSKPSKLNWIDENTVVTCGFSKAADRQ
LAVWDLRNDNSQLKLFNIDQGSGVLYPFYDPDTTCLFVAGKGDGNIRYYEVVGDSNYMYY
LESFKSNVPCKGSSFLPKRAVDVSVCEIMRAVKLTNNSLEFISFRVPRRSEAFQEDIYPD
CISSFPSMRAEEWFEGHNKHPIRVPIQDVTNTTQVEVEIKQTKTVAELERELKEAHEEIS
RLKHRISHLESRLG


>SteCoe_19728(CDS)
ATGGTGTCTATTGTGAGGCAGTCCAAATATCGGCATGTTTTCGGTGAAGAGCTCAAAGTC
AAATTTGAAGAAGTTAAATCCACAGCATTGGCTTCTGAAGGGACTTTGGTGGTGTCTAAT
GGGAAATACTCAGCGTTTTGTTGGGAAACAGCTGGGCCTGGGACATTAGCGGTTGTAGCT
CAATCTGAAGCTGGAAGGATCCCTCCAAATCATCCTTGGATCAAAGGTCATACTGCGAAC
ATATCAGATTTTGAGTTCAATCCTTATAATGATAATGAAATTGTCACTGGTTGTGATGAC
TCATTGATTAGATTATGGAGACTTTCTGGAGATAGAATTCATGAAGAAATCAACACCCCA
TTGACTACTTTGCAAGGACATTCAAGGAAAATATCAGTGTTGAATTTCCACCCTGCTGCC
GCTTATGTATTGGCTAGTGCTTCTCATGATAAAACGATTAAAGTTTGGAATATGGAGAGA
GCACAAGAAGTGTTGAGCTATGGGGGGATTACAGATAATGTATTTAGTTTGATGTGGAGT
CCTCATGGTAAGAGTTTAGCTTTTACAGCAAGAGATAAATATGCTAGGGGTATTGACCCT
AGGAGCAATAGGCCGAGTTTTGAGTTTTTGGCTCATGATGGCTCGAAACCTAGCAAGCTT
AATTGGATTGATGAAAATACAGTTGTAACTTGTGGCTTCTCTAAAGCTGCGGACCGTCAG
TTAGCTGTATGGGACTTAAGAAACGATAACAGCCAACTAAAACTTTTCAATATCGACCAA
GGTTCAGGAGTTCTTTACCCATTCTATGACCCTGATACCACATGCTTATTCGTAGCAGGT
AAAGGTGATGGGAATATCAGATATTACGAAGTAGTAGGTGATAGTAACTATATGTACTAC
CTTGAAAGTTTCAAATCAAACGTCCCTTGCAAAGGTTCAAGTTTCTTACCAAAACGAGCA
GTAGATGTCTCAGTATGTGAAATCATGAGAGCAGTCAAACTTACTAACAACTCTTTAGAA
TTCATATCATTCCGTGTACCACGACGAAGTGAAGCTTTTCAAGAAGATATTTACCCAGAC
TGCATATCAAGCTTTCCATCAATGCGTGCTGAAGAATGGTTTGAAGGTCATAACAAACAT
CCAATTCGTGTGCCAATACAAGATGTAACCAATACAACTCAAGTGGAAGTCGAAATCAAA
CAAACCAAAACAGTTGCTGAACTCGAGCGAGAATTAAAAGAAGCTCATGAAGAAATCTCT
AGACTTAAACATAGAATCTCTCATCTAGAAAGTCGTTTAGGTTAG