Identifiers and Description

Gene Model Identifier

SteCoe_19754

Standard Name

None

Aliases

None

Description

HATPase_c domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14442.0.g1080DNA gyrase/topoisomerase IV, s
ubunit A

WormBaseWBGene000107850

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19754(Protein)
MKSNPGEIIDFGGSTIEQIYQKKTPLEHILLRPDTYVGSIEMQDSKLWVWDSTKNKMVYR
QVQYVPGLYKIFDEILVNASDNFQRDKFMNKIMVTIDTQNSMVRVWNNGRGIPVVIHQDY
KIYVPELIFGQLLTSSNYDDTKKKVTGGRNGYGAKLTNVFSKKFIVETADSENMKKFSME
WTKNMSVHNEAKIDRLTKKEDFTCITFYPDLQRFDKDIVDLMTKRVYDLAGITDRKVKVF
LNDQEIKIKNFQEYVEMYLTDPDQPKIFEVVNERWEIGMSISEGVFQQVSFVNNICTTKG
GTHVTHVADQIISAISELVQKKFKKIEVKNPQIKQHLWLFVNCLIENPCFDSQTKDTMTL
KPSAFGSKCEISGKIMKEILKCGVVDHVMAYAKAKSEALLGKKVRQKKNERVFMNKLEDA
NEAGTKNGVNCTLILTEGDSAKSLAMAGIEVIGRDNYGVFPLKGKLLNVREASHSQLMNN
EEIQNIMKIVGLEPKKEYNSLQDLRYGCIMIMADQDLDGSHIKGLVINFVHFFWPGLLKK
QGFLKEFITPIVKATKGNDVISFFTLPEYETWTKTENASTWKIKYYKGLGTSTNKEAQEY
FSNLDRHRIEFVWKDDAKDEDAIDLAFNKKRADDRKQWLANLNPNTYLDMSQSKIEFSEF
IHRELILFSNYDNIRSIPSVMDGLKPGQRKILFSCFKRKLRSEIKVAQLSGYVAEHSAYH
HGEASLAGTIVGLAQNFVGSNNINLLMPLGQFGTRNMGGKDMASPRYIFTNLSHLTRKIF
LQEDDFLFSYQIEDGQRIEPIYYVPIIPMVLVNGSEGIGTGWSTNVPQYNPYDLINAYRA
RIKGKAFAENDIKPWYKGFKGTVEWIDRSGGGYELTGVMSRLGDDWLQISELPLRKWTGD
FKKFLEDFMKEDDPFITDMKEYHTENRVDFHIRIPGLNKYTDGALKKKFKLSTTISMANL
VLFDKDRKIVKYSNIDEIMEEHFLVREDYYKKRKEYLIAKLIRECEILANKVKFILAVVN
NQLIINKKQKATLVKELTSKGFATKKQLDTIYSEPSFLTDDNTKDIDPEPASNGPVASKE
YDYLLSMPLWSLTYEKVESLQNEHEQKTEELEELKKVSIYDMWTQDLDELASAIGRSWKD
EDDDRCNRPRAGNKGKSVKPKKVYKKRGSQDTKSNEKNVTAKKSLVGTNNNDKVMSIDKM
LSSIRTDRGKNSQEIEGKAILTTMKTPPKQINQSAADMKKIKEILSEGSESDKNDFSSFE
DSEED


>SteCoe_19754(CDS)
ATGAAATCTAACCCAGGGGAGATTATTGATTTTGGAGGGTCGACAATCGAGCAGATCTAT
CAGAAAAAAACTCCTCTTGAGCACATTCTCCTTCGTCCAGACACTTATGTCGGGTCTATA
GAAATGCAAGACTCCAAGCTCTGGGTTTGGGATAGCACGAAAAATAAAATGGTCTATCGG
CAGGTTCAATACGTCCCTGGACTTTACAAGATCTTTGATGAAATCCTTGTTAATGCATCA
GATAACTTCCAACGAGACAAGTTCATGAATAAAATTATGGTCACAATAGACACCCAAAAC
TCAATGGTCAGAGTCTGGAACAATGGTAGAGGAATACCAGTTGTCATTCATCAAGATTAT
AAAATCTATGTCCCCGAGCTTATCTTTGGACAGCTTTTAACATCAAGTAATTATGATGAT
ACTAAAAAAAAAGTTACAGGTGGGCGTAATGGCTATGGGGCTAAACTAACAAATGTGTTC
TCCAAAAAGTTTATAGTTGAAACTGCAGATTCTGAAAACATGAAAAAGTTTTCTATGGAA
TGGACTAAAAATATGAGTGTCCATAATGAAGCTAAAATCGACCGTTTAACTAAAAAAGAA
GATTTCACATGTATAACTTTCTATCCAGATCTGCAAAGATTTGATAAAGATATTGTTGAC
CTTATGACTAAAAGGGTATATGATTTAGCTGGAATTACTGATAGAAAAGTTAAAGTGTTT
TTAAACGATCAGGAGATTAAAATCAAAAACTTCCAGGAATATGTGGAAATGTACTTGACT
GACCCTGACCAGCCAAAAATCTTTGAAGTTGTTAATGAAAGGTGGGAAATCGGGATGTCT
ATAAGTGAAGGAGTTTTCCAGCAAGTAAGCTTTGTTAATAATATATGCACAACTAAAGGG
GGGACTCATGTTACACATGTCGCTGATCAGATAATATCAGCAATATCAGAACTTGTGCAG
AAGAAGTTTAAGAAAATCGAAGTTAAAAACCCTCAAATCAAACAGCATTTATGGCTTTTT
GTTAATTGTCTTATTGAAAACCCATGCTTTGATTCTCAGACTAAAGATACAATGACGCTT
AAACCGTCTGCTTTTGGGAGTAAGTGTGAGATAAGTGGGAAGATTATGAAGGAAATACTT
AAATGTGGGGTTGTTGATCATGTTATGGCATATGCGAAAGCTAAGTCAGAAGCTTTATTG
GGGAAAAAAGTTAGGCAAAAAAAAAATGAGAGGGTTTTTATGAATAAGCTCGAAGATGCG
AATGAAGCTGGAACGAAAAATGGGGTGAATTGTACGCTGATTTTGACTGAAGGGGATAGT
GCAAAGTCTTTAGCTATGGCAGGGATTGAAGTTATAGGTCGAGACAATTATGGGGTTTTT
CCGCTAAAAGGCAAACTTTTAAATGTTCGTGAAGCCTCACATTCTCAGCTCATGAACAAC
GAAGAAATCCAAAACATTATGAAAATCGTTGGCCTTGAGCCAAAAAAAGAGTACAACAGC
CTCCAAGATCTCAGATACGGATGCATAATGATTATGGCCGATCAAGATCTAGATGGCTCT
CACATAAAAGGTCTTGTTATAAACTTTGTGCACTTTTTCTGGCCTGGACTTCTGAAAAAG
CAAGGATTCCTTAAAGAGTTCATAACTCCTATAGTTAAAGCGACTAAAGGCAATGATGTT
ATCTCATTTTTTACATTGCCAGAATATGAAACTTGGACAAAAACTGAAAATGCATCGACT
TGGAAAATAAAGTACTATAAAGGACTTGGAACTTCAACAAATAAAGAAGCTCAGGAATAC
TTTTCTAACTTGGACAGGCATAGAATTGAGTTTGTTTGGAAAGATGATGCTAAAGATGAG
GATGCGATTGACTTAGCTTTTAATAAAAAAAGAGCAGATGATAGAAAACAATGGTTAGCC
AATCTCAATCCAAATACATATTTAGATATGAGTCAGTCTAAAATTGAATTCAGCGAATTT
ATTCATAGGGAATTAATACTTTTTTCTAACTATGACAACATAAGGTCAATCCCAAGTGTC
ATGGATGGTCTAAAGCCAGGTCAGCGGAAAATCCTCTTTTCTTGTTTCAAAAGAAAACTT
AGATCAGAAATAAAAGTCGCTCAACTCTCAGGTTATGTTGCTGAACATTCAGCCTACCAT
CATGGCGAAGCTTCATTGGCTGGAACAATAGTAGGCTTAGCTCAGAATTTTGTCGGTAGC
AACAATATAAACCTATTAATGCCATTAGGACAATTTGGGACAAGAAATATGGGTGGTAAA
GATATGGCAAGCCCAAGGTATATCTTTACAAATCTATCACATTTAACAAGAAAAATATTC
CTCCAAGAAGACGACTTTTTATTTTCATATCAAATAGAAGATGGACAAAGAATAGAGCCT
ATATATTATGTACCAATAATCCCTATGGTTTTGGTTAATGGCAGTGAAGGTATTGGAACA
GGATGGAGTACTAATGTTCCTCAATATAATCCATATGACTTAATTAATGCTTATAGGGCT
AGAATTAAAGGTAAAGCCTTTGCTGAAAATGACATAAAACCTTGGTATAAAGGGTTTAAA
GGTACAGTAGAGTGGATTGATAGGTCTGGTGGAGGATATGAGCTGACTGGGGTTATGTCA
AGGCTGGGTGATGATTGGCTACAGATATCAGAGTTACCTTTAAGAAAATGGACTGGGGAC
TTTAAAAAGTTCCTTGAGGATTTTATGAAGGAAGACGACCCTTTTATTACTGATATGAAG
GAGTATCATACTGAAAATAGAGTTGATTTTCATATAAGAATCCCAGGACTCAATAAATAT
ACTGATGGGGCTCTCAAGAAAAAATTCAAGCTTTCAACTACAATATCAATGGCCAACCTT
GTGCTTTTTGATAAAGATAGGAAAATTGTCAAGTATTCCAACATTGATGAAATTATGGAA
GAGCACTTTTTAGTCAGAGAAGATTACTATAAGAAAAGAAAAGAATATCTAATAGCCAAA
CTTATACGTGAATGTGAAATACTTGCTAATAAAGTTAAGTTTATTCTGGCTGTTGTAAAT
AATCAGCTAATTATTAATAAAAAACAAAAAGCAACACTTGTTAAAGAGCTTACTTCTAAA
GGCTTTGCTACAAAGAAGCAGCTTGACACAATTTATTCAGAGCCAAGCTTCCTAACTGAT
GACAATACTAAAGATATAGACCCAGAGCCTGCATCCAATGGTCCAGTTGCTTCAAAGGAA
TATGATTATTTACTTAGTATGCCTCTTTGGTCTTTGACTTATGAAAAGGTTGAATCTTTG
CAAAATGAGCATGAGCAGAAAACAGAAGAGCTTGAAGAGCTTAAAAAAGTATCGATTTAT
GATATGTGGACTCAAGACTTAGATGAGTTGGCTAGTGCTATAGGAAGGTCTTGGAAAGAT
GAAGATGACGATAGGTGTAATCGACCAAGGGCTGGGAATAAGGGCAAGTCAGTAAAACCT
AAGAAAGTGTATAAGAAAAGAGGTAGTCAAGATACTAAAAGTAATGAAAAAAATGTGACT
GCAAAGAAAAGCCTTGTTGGGACAAATAATAATGATAAAGTAATGAGCATTGATAAAATG
CTCAGCAGCATAAGAACTGATAGAGGGAAAAATAGCCAAGAAATAGAGGGAAAAGCTATT
TTGACTACTATGAAAACACCTCCAAAACAAATTAATCAATCTGCTGCTGATATGAAGAAG
ATTAAAGAAATTCTTAGTGAAGGAAGTGAAAGTGACAAGAATGATTTTTCAAGTTTTGAA
GACTCTGAGGAAGATTAG