Identifiers and Description

Gene Model Identifier

SteCoe_19993

Standard Name

None

Aliases

None

Description

ThiF domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig678.1.g522.001470128041443e-75ThiF family

Tetrahymena ThermophilaTTHERM_001853504.834541638053336e-68ubiquitin-activating enzyme
WormBaseWBGene000043411.9006199352650016e-55
Saccharomyces CerevisiaeYPR066W2.9374821117108028e-30Protein that activates Rub1p (
NEDD8) before neddylation; act
s together with Ula1p; may pla
y a role in protein degradatio
n; GFP-fusion protein localize
s to the cytoplasm in a puncta
te pattern

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_19993(Protein)
MNTSSLSPKDFIPGEDTMSMLTEYARVLVIGAGGLGCEILKDIALSGFKDIEVIDLDTID
ITNLNRQFLFRKENVGEYKAEVAARFIQSRVLGCKVKAHTQPIQDFDEDFYSSFHIIIAG
LDNIEARRWLNSMLHSMVKFDENGEILPETVRPLIDGGTEGFKGQARLIIPFKTACFECT
MKMVTPQQRFPLCTIAETPRLPEHCITYAQIIEWEKAFPEKKLDKDSPEDMNWVYQKALD
RANHYGIEGVTYMKTIGVVKNVIPAIASTNALISAACVAEALKVATYLSNPMDNYFMYMG
QTGIHTATIQIEKDHECLVCSKKPINLTVSRNSKLREMIDLLKENKKYNMISPAISGMLG
PLYMPKPPVLEEKHRFKLDLTFAELIDKNYFRDGDGLIVTDPSFNSSLTLIVNLV


>SteCoe_19993(CDS)
ATGAACACTTCAAGTCTAAGCCCAAAAGATTTTATCCCAGGTGAAGATACTATGTCTATG
CTTACCGAATATGCTAGAGTCTTAGTAATCGGTGCTGGTGGTTTAGGTTGTGAGATTCTT
AAAGATATAGCTTTATCAGGTTTCAAAGATATCGAAGTAATTGATCTTGATACAATAGAC
ATAACTAATCTAAATCGACAATTCTTATTCCGCAAAGAAAATGTAGGTGAATATAAAGCT
GAAGTTGCTGCAAGGTTTATTCAGTCTAGGGTGTTAGGGTGTAAAGTAAAAGCTCATACT
CAGCCAATTCAAGATTTTGATGAAGATTTTTATAGTAGTTTTCATATAATCATTGCAGGT
CTAGACAATATCGAAGCCAGAAGGTGGTTAAACTCAATGCTTCATTCAATGGTGAAATTC
GATGAAAACGGGGAAATCTTACCAGAAACTGTAAGACCGCTTATTGATGGGGGAACTGAA
GGATTTAAAGGTCAAGCAAGGTTGATAATCCCATTTAAAACCGCTTGTTTCGAATGTACA
ATGAAAATGGTCACCCCACAACAAAGATTTCCATTATGCACAATAGCTGAAACCCCAAGA
TTGCCTGAGCATTGTATAACTTATGCGCAGATTATAGAATGGGAAAAAGCTTTCCCTGAG
AAAAAACTTGATAAAGATAGTCCTGAAGATATGAACTGGGTATATCAAAAAGCACTTGAT
AGGGCTAATCATTATGGTATTGAAGGAGTTACATATATGAAAACAATAGGTGTAGTCAAA
AATGTTATACCAGCGATAGCTTCAACTAATGCTCTTATCTCTGCAGCTTGTGTTGCTGAA
GCTTTAAAGGTCGCTACATATTTGAGTAACCCAATGGATAATTATTTTATGTATATGGGT
CAAACAGGTATCCACACAGCGACTATACAGATTGAAAAAGACCATGAGTGCTTGGTTTGT
AGTAAAAAACCTATAAATTTAACTGTGTCTAGAAACTCAAAACTTAGAGAAATGATTGAT
TTGCTTAAAGAAAATAAAAAATATAATATGATTAGTCCAGCTATTAGTGGAATGCTTGGA
CCTTTGTATATGCCTAAACCTCCTGTTTTAGAAGAAAAACATAGATTTAAGTTGGATTTG
ACTTTTGCTGAACTTATTGACAAGAATTATTTTAGAGATGGTGATGGGCTTATTGTCACT
GATCCGAGCTTTAATAGCTCACTTACGTTAATCGTTAATTTAGTATAG