Identifiers and Description

Gene Model Identifier

SteCoe_2008

Standard Name

None

Aliases

None

Description

KH_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYNL178W7.281290178321643e-33Protein component of the small
(40S) ribosomal subunit; has
apurinic/apyrimidinic (AP) end
onuclease activity; essential
for viability; homologous to m
ammalian ribosomal protein S3
and bacterial S3
WormBaseWBGene000044727.281290178321643e-33
Oxytricha TrifallaxContig3798.0.g425.900090541597061e-29Ribosomal protein S3, C-termin
al domain

Tetrahymena ThermophilaTTHERM_011515001.603810890548638e-28Homolog of yeast RPS3, human R
PS3, bacterial RPS3;

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2008(Protein)
MEGENQAHTICKKRKFIQEGLKRAELHCFLARTLAQEGYAGMELVSTSSQTTVSIYATQI
DKVVGENNTRVRELNSLIRKRFNYAKDTLDLLARKVPNRGVSAAVQAESLKYKLLNGFPV
RMAANGVIRFVMKSGAKGIEVAVSGKIRAQRAKTMKFRDGYFISSGEPRRVFVDEAVRHV
HMKQGVLGVQVRIMLSHDPEGIVGPKKPLPDFVEIIEPKDQVA


>SteCoe_2008(CDS)
ATGGAGGGTGAGAACCAAGCTCATACTATATGCAAAAAGCGTAAGTTCATTCAAGAAGGT
CTCAAACGAGCTGAATTACACTGCTTCCTAGCCAGAACCCTAGCACAAGAAGGGTACGCA
GGCATGGAACTAGTCTCAACTTCAAGCCAAACCACCGTCAGCATCTACGCCACACAAATC
GACAAAGTTGTAGGTGAAAACAACACCCGTGTCAGAGAACTCAACTCACTTATCCGCAAA
CGTTTTAACTACGCCAAAGATACACTTGACCTCCTTGCTAGAAAAGTCCCTAACAGAGGT
GTTAGTGCTGCAGTCCAAGCTGAAAGTTTGAAATACAAGCTTTTGAATGGTTTCCCAGTC
CGTATGGCTGCTAATGGTGTAATTAGATTTGTTATGAAGAGTGGAGCTAAAGGTATTGAA
GTGGCTGTTTCAGGAAAAATCAGAGCCCAAAGAGCTAAGACGATGAAGTTCAGAGACGGA
TACTTTATATCATCAGGAGAACCAAGAAGAGTTTTTGTTGATGAAGCTGTTAGGCATGTT
CATATGAAGCAAGGTGTGTTAGGTGTGCAAGTAAGGATTATGCTTTCACATGATCCTGAA
GGTATTGTTGGTCCGAAGAAGCCTTTGCCAGACTTTGTGGAAATTATTGAGCCTAAGGAT
CAGGTTGCTTAG