Identifiers and Description

Gene Model Identifier

SteCoe_20130

Standard Name

None

Aliases

None

Description

Helicase_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007259301.368539471173853e-44DExD/H box RNA helicase
Oxytricha TrifallaxContig13621.0.g368.194012623990515e-40Mitochondrial degradasome RNA
helicase subunit C terminal

WormBaseWBGene000074441.8048513878454153e-35
Saccharomyces CerevisiaeYPL029W2.6786369618080778e-33ATP-dependent RNA helicase; co
mponent of the mitochondrial d
egradosome along with the RNas
e Dss1p; the degradosome assoc
iates with the ribosome and me
diates RNA turnover; also requ
ired during splicing of the CO
X1 AI5_beta intron

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20130(Protein)
MAKNLGKKIADLRMPHEWWEQARSMTRNFHMHFGPTNSGKTYSALEYLKKAPKGVYCAPL
RLLAAEVYENLNKSGIKCSLITGQEIKIVPDASHVACTIESLKLTEKYDCAVVDEVQMIA
DESRGSAWTNAILGLQAKEIHLTGEPRSKNLLFNIFDRTKDSYSEYLYKRMSSLRLCPPI
VSTNELKPGDCLIAFSRRKCHAIKNFIEKKQPGSCAIIYGNLPPEVRKNQAERFNSQQQK
YLIATDAVGMGLNYKIDRIIFMETSKHDGKKKRRLFPYEIKQIAGRAGRYMSNGYVTSTT
MSDFKEINIALSYNQEIKIDRAGLTPFYEQLEEFAEFNFSSGKSLTYSNLLTQFSKFAKL
ENIYFLQSIYEACCIANSIQSIGLSLQQMHLFCNIPIRIKNSAVLKVAQIFAGEIKKEKE
VKFINYDDNLKDMNLENLENIYNLCEMYHALSRKFGREMFVDCTDVRAFCLLVSMEIQDR
LNKEENAMLEFQLSQN


>SteCoe_20130(CDS)
ATGGCAAAAAATCTAGGCAAAAAAATAGCAGATTTGCGCATGCCACACGAGTGGTGGGAA
CAAGCCAGAAGCATGACAAGAAACTTTCACATGCATTTTGGGCCTACTAATTCCGGAAAA
ACTTACTCAGCTTTAGAGTATCTTAAAAAGGCTCCAAAAGGTGTCTATTGTGCTCCACTC
AGGTTATTAGCAGCCGAAGTTTATGAAAATTTAAATAAAAGTGGAATTAAATGTTCACTT
ATAACAGGCCAAGAGATTAAAATAGTTCCTGATGCATCACATGTAGCTTGCACAATCGAA
TCTTTAAAGCTGACCGAAAAATATGACTGTGCTGTGGTAGACGAAGTGCAAATGATTGCT
GATGAGAGTCGAGGATCAGCATGGACAAATGCGATTCTTGGTTTACAAGCTAAAGAAATT
CATTTGACTGGTGAGCCAAGAAGCAAAAATTTGCTTTTCAATATTTTTGATAGAACAAAA
GATAGTTATAGCGAATACTTGTATAAAAGAATGAGTTCACTCAGATTATGTCCACCCATA
GTAAGCACAAATGAATTAAAGCCAGGGGATTGTCTTATAGCTTTTTCTCGTCGTAAATGC
CATGCTATTAAGAATTTTATTGAAAAAAAGCAGCCAGGCTCATGCGCAATAATTTATGGA
AATCTGCCACCCGAAGTGCGGAAAAATCAAGCTGAGAGGTTTAACAGTCAGCAACAAAAG
TACCTTATAGCTACAGATGCTGTTGGTATGGGATTGAACTATAAAATTGACAGAATAATT
TTCATGGAGACTTCAAAGCATGATGGGAAAAAAAAGCGCAGGCTTTTCCCTTACGAAATA
AAGCAAATAGCTGGAAGAGCAGGAAGATATATGAGTAATGGATATGTTACATCAACTACA
ATGTCTGACTTTAAGGAAATCAATATTGCCTTGAGTTATAATCAGGAAATAAAAATTGAC
AGAGCAGGGCTCACACCTTTTTATGAACAATTAGAAGAGTTTGCAGAGTTTAATTTTTCT
TCAGGGAAATCACTGACTTACTCTAATCTTTTAACTCAATTCTCAAAATTTGCAAAATTG
GAAAATATCTACTTTTTACAAAGTATTTATGAAGCTTGCTGTATTGCAAATAGCATACAA
TCAATTGGGCTCTCTCTCCAGCAAATGCATCTGTTTTGTAACATCCCTATAAGAATTAAA
AATTCAGCAGTATTAAAAGTAGCACAAATATTTGCTGGCGAAATTAAAAAAGAGAAAGAA
GTTAAATTTATAAACTATGATGATAATTTGAAGGATATGAATTTGGAAAATTTAGAAAAT
ATATACAATCTGTGCGAGATGTATCATGCACTGTCTAGAAAGTTTGGGAGAGAAATGTTT
GTTGATTGCACTGATGTTAGAGCATTTTGTTTATTGGTTTCTATGGAAATTCAAGATAGG
TTGAATAAGGAAGAAAATGCTATGCTTGAATTTCAGCTGAGTCAAAACTAG