Identifiers and Description

Gene Model Identifier

SteCoe_20183

Standard Name

None

Aliases

None

Description

Methyltr_RsmB-F domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13211.0.g843.720075976020836e-44NOL1/NOP2/sun family

Tetrahymena ThermophilaTTHERM_006845401.0112214926104486e-43NOL1/NOP2/sun family protein
Saccharomyces CerevisiaeYBL024W8.194012623990515e-40S-adenosyl-L-methionine-depend
ent tRNA: m5C-methyltransferas
e; methylates cytosine to m5C
at several positions in tRNAs
and intron-containing pre-tRNA
s; increases proportion of tRN
ALeu(CAA) with m5C at wobble p
osition in response to hydroge
n peroxide, causing selective
translation of mRNA from genes
enriched in TTG codon; loss o
f NCL1 confers hypersensitivit
y to oxidative stress; similar
to Nop2p and human proliferat
ion associated nucleolar prote
in p120
WormBaseWBGene000216861.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20183(Protein)
MAEEDFNAFWNILQEQLPVTFRINPMNLNYQYLIDSFSSQGFLSNLLASETKIKLEQVLW
YPGKLTWQINSNRSELRKQENIKQFHSFLQKANESGLITRQELVSMIPPLVLKPNPGEKI
IDMCAAPGSKTAQLIEIMQGQGLVVANDVDTNRAYMLIHQLHRSNTSSMIVVNHQAQNFP
KTDFMFDKVLCDVPCSGDGAIRKLPSKWRKWNVKDGQGIHTLQISIFRRGVQLLKPNGII
CYSTCSLNPIEDEAVVNIVAKEFDLEILDLPAILGEMCPGLIVRRGLKSWKVLGNAKDKE
SSPFVEYSAYSEVPENITTIKPTMFPVDVVQGLENTIRILPHDQNTGGFYIGLFRKKSNA
PEGKIVDENIPEKNAEDCSEKPKKRRKILDREQPLYIPLENNEEYANLANYFGLEDFVMS
QLLTPLTMNKKNLFFVSPEVKDFLNRNESKVLKVLNVGVCAFTKNKHKPTKGVCKYRPHQ
DALPFISGFIKSNRLYSEELELLKVLLKTGFFETKNYLEVPNGYYVMKFSPLEEEVLVLK
VTEDKFQTVIPREHINSLLIRYPSLDT


>SteCoe_20183(CDS)
ATGGCTGAAGAGGACTTTAATGCGTTCTGGAATATCTTACAAGAGCAACTGCCTGTGACA
TTCCGTATAAACCCAATGAACCTAAACTATCAGTACTTAATAGACTCTTTTTCATCTCAA
GGATTTCTCTCTAATTTATTAGCTTCAGAGACTAAAATTAAACTAGAACAAGTCCTTTGG
TATCCAGGGAAACTCACTTGGCAAATCAATAGTAACAGGTCTGAGCTCAGAAAACAAGAA
AACATCAAACAATTTCATTCTTTCTTACAAAAAGCTAATGAATCTGGTCTTATAACAAGG
CAAGAACTTGTCAGTATGATTCCCCCATTAGTCCTCAAGCCAAACCCAGGGGAAAAAATT
ATTGATATGTGTGCTGCACCAGGTAGTAAAACAGCTCAACTTATAGAAATCATGCAAGGA
CAAGGTCTTGTTGTAGCTAATGATGTAGATACAAACAGAGCATATATGCTTATTCATCAA
CTTCATAGATCCAATACAAGTTCAATGATAGTAGTAAATCATCAAGCACAAAATTTCCCT
AAAACTGATTTTATGTTCGATAAAGTTCTTTGTGATGTTCCATGCTCAGGAGATGGGGCA
ATTAGAAAGTTACCATCTAAATGGAGAAAATGGAATGTTAAAGATGGTCAAGGTATACAC
ACACTACAAATTAGCATATTTCGCCGTGGTGTTCAGTTACTTAAACCAAATGGGATTATA
TGTTATTCAACTTGTTCATTAAATCCAATTGAAGATGAAGCTGTAGTTAATATTGTGGCT
AAAGAATTTGATCTTGAGATTTTAGATTTACCTGCTATACTTGGGGAAATGTGCCCAGGA
CTTATTGTTAGAAGAGGGTTGAAATCATGGAAAGTTTTAGGGAATGCTAAAGATAAAGAA
TCAAGTCCTTTTGTTGAATACTCAGCATATTCTGAAGTCCCAGAAAACATAACTACAATC
AAACCAACGATGTTTCCTGTTGATGTAGTTCAAGGACTTGAAAATACTATACGAATTCTT
CCTCATGATCAAAACACTGGAGGATTTTATATTGGGTTGTTTAGAAAAAAGTCCAATGCC
CCTGAAGGGAAAATTGTTGATGAAAATATCCCTGAAAAAAATGCTGAAGACTGCTCGGAA
AAACCAAAAAAACGTAGAAAAATACTAGACAGGGAACAACCTTTGTATATACCTCTTGAG
AATAATGAAGAATATGCAAACCTCGCAAATTACTTTGGTCTTGAAGATTTTGTTATGAGC
CAATTGTTAACACCTTTGACTATGAATAAAAAAAACTTGTTTTTCGTTTCTCCTGAAGTT
AAGGATTTTTTGAATAGAAATGAAAGTAAAGTACTTAAGGTTCTTAATGTTGGGGTATGT
GCATTTACTAAAAATAAACATAAACCTACTAAAGGAGTTTGTAAGTATAGACCACATCAA
GATGCTTTACCATTTATATCTGGGTTTATTAAAAGTAATAGGCTTTATTCAGAGGAATTG
GAGTTATTGAAGGTATTATTGAAGACTGGGTTTTTTGAGACTAAAAATTATTTGGAAGTG
CCGAATGGATATTATGTTATGAAATTTAGTCCTTTAGAAGAAGAAGTTTTGGTATTAAAA
GTTACTGAGGATAAGTTTCAAACAGTAATCCCAAGAGAGCATATAAATAGTTTGCTCATT
CGCTATCCATCATTAGATACTTAA