Identifiers and Description

Gene Model Identifier

SteCoe_20343

Standard Name

None

Aliases

None

Description

SAS-6_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003882005.380186160021138e-32basal body protein; identified
in proteomic analysis
Oxytricha TrifallaxContig17018.0.g330.0000000000018795288165390832hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20343(Protein)
MKRHTSSSSLSKGFSESRAYDVFEPEVVNVPVKIRSLDREEKFALLHISVSMNSVTGTHH
QVLVIEVTDETDPFFLYALECGESEFHAIKQEQAILVDFLTFPLKLIELLQMCIRKVEDS
PRFICTLDKGHGFEGTLNICETNLFRQITHLSLKFRSGSDEIIKKHLAGKLKEYKLNCEN
LEVKLSQTEESLQLRNAEYNDSVKQFDALSAEFERKIEENKLAWQEKIQTLKQQAMESQQ
KLMSQYEQEKRISAEKNEKALEETISKLDFTQGKLNEISAIKYSLESKEREMTLKMAQIE
HELEIATNELQHLRKTNKNLDCNKFDQEKALTEYKLRLQNMERQIQDKEELNQKLTALIQ
TNSEFKGHQDDTMSMLKATISKLEDKLQQSANEINKGNSIIQKLQSDVKANKQKLKLKNT
VVLQQENAIQQKQEHIDNFDKQLFVLKRDLEKKDEKIKSLENDVTELKTKLEDAQKVITD
NMNTINYLNTKLNEAEKFRPGHLQDRPQYTTNYKLTTNPSPISFRPSPYSVEHLRSTTPR
TSSYTSIPDSEPFPKYLEAVKYKEPNNS


>SteCoe_20343(CDS)
ATGAAGCGGCATACTTCGAGCTCATCATTGAGTAAAGGTTTTTCAGAGTCTCGGGCTTAT
GATGTGTTTGAACCTGAGGTTGTAAATGTTCCTGTTAAAATCAGAAGCTTAGATAGAGAA
GAGAAATTTGCTTTGTTGCATATTTCGGTATCTATGAATAGTGTTACGGGAACTCATCAT
CAGGTTTTGGTTATTGAGGTAACTGATGAGACTGACCCATTTTTCTTGTATGCTTTGGAA
TGCGGTGAGTCAGAATTCCATGCTATTAAACAAGAACAAGCTATTTTAGTGGATTTTTTG
ACGTTCCCGCTTAAACTTATTGAACTGCTACAGATGTGTATTAGGAAAGTTGAGGATAGT
CCTAGGTTTATTTGCACGCTAGATAAAGGACATGGATTTGAAGGGACTCTGAACATATGT
GAAACCAACCTTTTTAGGCAAATAACTCACCTTTCATTAAAATTTCGTAGCGGCAGTGAT
GAAATCATTAAAAAGCACTTAGCGGGAAAGCTTAAAGAATACAAATTAAACTGTGAGAAC
TTAGAAGTTAAGCTTTCACAAACTGAAGAATCATTACAACTAAGAAACGCTGAATACAAC
GATAGTGTTAAACAATTTGATGCCTTATCTGCAGAATTCGAAAGAAAAATTGAAGAAAAC
AAGCTTGCGTGGCAAGAAAAAATCCAAACACTAAAACAACAAGCAATGGAAAGTCAGCAA
AAACTTATGAGTCAATACGAGCAAGAAAAGCGAATTTCAGCAGAAAAAAATGAAAAAGCA
TTAGAAGAAACAATAAGTAAATTAGATTTTACACAAGGGAAACTTAATGAAATTTCTGCA
ATAAAATATTCACTTGAAAGTAAAGAAAGAGAAATGACCTTGAAAATGGCGCAGATTGAA
CATGAACTTGAGATAGCAACTAATGAACTTCAGCATTTAAGAAAAACAAATAAAAATTTG
GATTGTAATAAATTTGACCAAGAGAAAGCTTTAACTGAGTATAAACTTAGACTACAGAAT
ATGGAAAGACAAATTCAAGATAAAGAAGAGCTTAATCAAAAACTTACTGCGCTTATTCAA
ACTAATTCTGAGTTTAAAGGACATCAGGATGATACAATGTCTATGCTTAAAGCAACTATT
TCAAAATTAGAAGATAAACTTCAACAAAGCGCTAATGAGATAAATAAAGGTAATTCTATA
ATACAAAAGCTTCAAAGTGATGTTAAGGCTAATAAACAAAAACTTAAACTTAAAAATACT
GTTGTCTTACAGCAAGAAAATGCAATTCAGCAAAAACAAGAACATATTGATAATTTTGAT
AAACAACTTTTTGTATTGAAAAGAGATTTAGAGAAAAAAGATGAAAAAATAAAAAGTTTA
GAAAATGATGTTACTGAACTTAAAACTAAACTGGAAGATGCTCAAAAAGTTATAACAGAT
AATATGAATACAATAAATTACTTAAACACTAAACTTAATGAAGCTGAAAAGTTTCGCCCT
GGCCATCTTCAAGATCGACCTCAATATACTACTAATTATAAGCTTACAACAAACCCATCG
CCAATATCCTTTAGGCCTTCACCTTATTCAGTAGAGCATTTAAGATCAACAACCCCAAGA
ACATCTTCATATACAAGCATACCTGATTCAGAGCCTTTTCCTAAGTATCTTGAAGCTGTT
AAGTATAAAGAGCCAAATAATTCTTAA