Identifiers and Description

Gene Model Identifier

SteCoe_20459

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004210000.00000000000003442477108469977RNA recognition motif-containi
ng protein; 2014 reannotation
incorporated RRM19 (TTHERM_004
21010) into this gene model
Oxytricha TrifallaxContig18677.0.g100.00000000000003442477108469977RNA recognition motif. (a.k.a.
RRM, RBD, or RNP domain)

WormBaseWBGene000068070.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20459(Protein)
MVDQSLKIFATKLPREWTDEQVREYFSAQAAVLEVSVFKDGGKSLGCAYIKFQSKTEAEE
VIKNLSKEVISNKKIKLRWADGEAERLKIDRAPLPKPARSKYIQYTSSDGRPYYYNTETG
LTQWEEPIEMAQPIKTPSAPQGPPGCNLFLFHLPIEWNEQDLIKYFSPFGNVISARIMHE
KESGRSKGFGFISYDSKISAVNAVKMMNGYQVLGKRLKVEIKKGEYLPEYVLYPSYQPNP
L


>SteCoe_20459(CDS)
ATGGTAGATCAAAGCTTAAAGATTTTTGCAACAAAACTGCCTAGAGAATGGACAGATGAG
CAAGTGAGAGAGTATTTTTCGGCTCAAGCAGCAGTTCTTGAAGTTTCAGTGTTCAAAGAC
GGCGGGAAAAGTCTTGGATGTGCATATATAAAATTCCAAAGCAAAACCGAAGCAGAAGAA
GTGATAAAAAACTTGAGTAAAGAAGTAATTTCTAATAAGAAAATCAAGCTTCGTTGGGCA
GATGGTGAAGCAGAAAGATTAAAAATAGACAGGGCCCCATTACCAAAACCAGCTCGGTCT
AAATATATCCAATATACATCATCAGATGGAAGGCCTTATTATTACAACACAGAAACAGGA
TTAACTCAATGGGAAGAACCAATAGAAATGGCCCAGCCTATTAAAACTCCTTCTGCTCCT
CAAGGTCCACCTGGTTGTAATTTATTTTTGTTTCATTTGCCTATTGAGTGGAATGAACAA
GATTTGATTAAATACTTTTCACCTTTTGGTAATGTGATAAGTGCAAGAATCATGCATGAG
AAAGAGAGCGGAAGAAGTAAAGGCTTTGGGTTTATTAGCTATGACTCTAAGATAAGCGCT
GTCAATGCTGTGAAAATGATGAATGGATATCAAGTTTTAGGTAAAAGATTAAAGGTTGAA
ATTAAAAAAGGAGAATACTTGCCTGAATATGTTTTATATCCTTCGTATCAGCCTAATCCT
TTATAG