Identifiers and Description

Gene Model Identifier

SteCoe_20569

Standard Name

None

Aliases

None

Description

Kinesin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002662302.6395702969591894e-66Kinesin motor domain containin
g protein
Oxytricha TrifallaxContig8010.0.g801.580420060273613e-61Kinesin motor domain

WormBaseWBGene000068409.221146422925876e-47
Saccharomyces CerevisiaeYBL063W2.1705220113036395e-29Kinesin-related motor protein;
required for mitotic spindle
assembly, chromosome segregati
on, and 2 micron plasmid parti
tioning; functionally redundan
t with Cin8p for chromosomal b
ut not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20569(Protein)
MKFGFDKAFSPTSSQESVYEIAAKPIVNAVMQGFNGTILAYGQTSSGKTFTMTGPNMDDP
DQMGIIPRMVTTVFDQISQADDCIEFSVKVAYCEIYLEKIKDLLDTSKINLKIHEDRARG
IYIEGLSEQYVSCEEEVYDLMKIGSENREVAYTNMNSGSSRSHSLFLLTVSQTNSKDLSG
KTGKLYLVDLAGSEKVSKTGAAGKRLEEAKNINKSLTVLGQVIYSLTDGKSTHIPYRNSK
LTRVLQDSLGGNSKTCLIVTCSPSPYNESETISTLRFGIRAKAIKNKPKVNREYTVAELK
LMLSKVQEEMERKDNYIQKLEEGLKKTGVQINDIEGVKNDQGQGEKLDYDEIMAEIEDLK
IRLSDEVENNKILTEENKQQNTMIQEMNNEKSLLNYKYTQLQESNACLEQKIIEQEGLIE
KLVISKEHLESDNQEILKIKMSMEQMINEKDLEIADLKMHISGNVKKTPEIVYDLRAQVQ
VEKEKNDELCVKVKELETSMESTLSLLKSDSPNIQEALIKQAVDKEKSLWLEERKSIYRD
LKNRINKVIELEITLDAAKEKYESLENAMTLGEKKLKQRTDLLAKNLEQLSAMYKQILNE
KATSKVDIKVLERKNTRLTERNYNLEEENKKLMTKVTLYESKIKMLEDEISITGPISRNS
INSSRTGRPPTYKVRKSIRGGLPSSSRNGSVLV


>SteCoe_20569(CDS)
ATGAAGTTTGGTTTTGATAAAGCATTTTCCCCGACGAGCAGTCAAGAAAGTGTATATGAA
ATAGCTGCGAAGCCGATTGTCAATGCTGTAATGCAAGGTTTCAACGGGACAATCCTAGCC
TACGGACAGACTTCATCTGGTAAAACCTTCACAATGACAGGTCCAAATATGGACGATCCT
GATCAAATGGGTATAATCCCTCGTATGGTAACAACAGTTTTCGATCAAATTTCCCAAGCC
GATGACTGCATAGAGTTTTCAGTAAAAGTAGCCTATTGTGAAATCTACCTTGAAAAAATC
AAAGACCTTCTTGATACTAGTAAAATCAATCTTAAAATTCATGAAGACCGGGCTCGAGGA
ATTTACATCGAAGGACTATCTGAACAATACGTAAGTTGTGAAGAAGAGGTTTACGATTTA
ATGAAAATCGGTTCAGAAAACCGTGAAGTCGCATATACAAACATGAATTCAGGTAGTTCA
AGATCTCATTCATTATTTCTCCTAACTGTTAGTCAAACAAACTCTAAAGATTTATCAGGT
AAAACTGGAAAACTGTATCTTGTCGATCTTGCTGGGTCTGAAAAAGTTTCGAAAACTGGA
GCTGCAGGTAAACGTTTAGAAGAAGCTAAAAACATCAATAAATCTTTAACAGTTCTTGGT
CAAGTCATATATTCTTTAACAGATGGAAAATCAACACATATTCCATATAGAAATTCTAAG
TTAACAAGAGTATTACAAGATTCACTTGGGGGTAATTCTAAGACATGTTTAATTGTCACA
TGTTCTCCTTCACCTTATAATGAATCAGAAACAATAAGTACTTTAAGATTTGGTATTAGA
GCTAAAGCTATTAAAAATAAACCAAAAGTTAATAGAGAATATACTGTTGCTGAATTAAAA
CTTATGTTATCTAAAGTTCAAGAAGAGATGGAAAGGAAAGATAATTATATACAAAAACTT
GAAGAAGGGTTAAAAAAAACTGGGGTTCAGATTAATGATATAGAAGGAGTGAAAAATGAT
CAAGGACAAGGGGAGAAACTTGATTATGATGAAATTATGGCTGAGATTGAGGATTTAAAG
ATTAGGCTTTCTGATGAAGTTGAGAATAATAAGATACTTACTGAGGAAAATAAACAACAA
AATACGATGATACAGGAAATGAATAATGAGAAATCGTTGTTGAATTATAAATATACACAA
TTACAAGAGTCAAATGCATGTCTTGAACAAAAGATTATTGAACAAGAAGGGTTGATTGAA
AAATTAGTTATTTCTAAAGAACATTTAGAGTCAGATAATCAGGAGATTTTGAAAATTAAA
ATGTCGATGGAACAGATGATAAATGAAAAAGATCTGGAAATCGCTGATTTGAAAATGCAT
ATTTCGGGGAATGTGAAGAAAACCCCAGAAATTGTTTATGACCTTAGAGCACAGGTACAG
GTGGAGAAGGAGAAAAATGATGAACTTTGTGTTAAGGTTAAAGAGCTAGAAACTAGTATG
GAAAGTACACTTTCATTACTGAAATCTGATTCACCAAATATTCAAGAAGCACTAATAAAG
CAAGCTGTTGATAAAGAAAAATCTTTATGGCTAGAAGAACGAAAATCCATATATCGTGAT
CTAAAAAATAGAATCAATAAAGTTATTGAGCTAGAAATAACCCTCGATGCAGCTAAAGAA
AAGTATGAAAGCCTAGAGAACGCTATGACTTTAGGAGAAAAAAAATTAAAACAACGTACT
GATCTACTCGCTAAAAATCTTGAACAATTAAGCGCAATGTACAAGCAAATATTAAATGAA
AAAGCGACTTCTAAAGTTGACATAAAAGTGCTGGAAAGAAAAAATACCCGATTAACTGAG
CGGAATTACAATTTAGAAGAAGAAAACAAAAAATTAATGACTAAAGTTACCCTATACGAA
TCAAAAATAAAAATGCTTGAAGATGAGATATCAATAACAGGGCCTATCTCAAGAAACTCT
ATCAACAGTTCTCGTACTGGTCGTCCTCCAACATATAAAGTTAGAAAAAGCATAAGAGGT
GGTCTTCCTTCATCATCAAGAAATGGTTCAGTTTTGGTTTAG