Identifiers and Description

Gene Model Identifier

SteCoe_20593

Standard Name

None

Aliases

None

Description

Peptidase_C97 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006640301.9287498479639178e-22SUMO-specific protease; deSUMO
ylase; removes Smt3p from prot
ein substrates; Desi1p is dist
inct from the Sentrin-specific
proteases (SENP) family of de
SUMOylases
Oxytricha TrifallaxContig17686.0.g391.1548224173015786e-17PPPDE putative peptidase domai
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20593(Protein)
MAEVTLQVYDISQGMAKVLSPMFIGKQIDGIWHTSIVVFGKEYYFGGGICCDVPLTTPFG
MPVQKISMGFTRKSQEDLMKFFNCVTHRFTVDSYHIVDHNCNNFTDEVLRYLLDKRIPEN
ISGLPRELLNTPIGQQFAPMINSMMNMKNTMFPTTIVTDPFADYVSHEVFFPEMKKIDSY
PVFDEFVKNGGLVGYWDPRIDECSELVEIVGGLKCRVGFCDVLRSFFLAPEQKIPCFRAY
AIGGDLLCEYDFETFKNSVEEINELMNIS


>SteCoe_20593(CDS)
ATGGCTGAAGTGACCCTACAAGTCTATGATATCTCACAAGGAATGGCTAAAGTTTTAAGC
CCAATGTTTATAGGTAAGCAAATAGATGGAATTTGGCATACTTCTATAGTAGTATTTGGA
AAAGAGTATTATTTCGGAGGAGGTATTTGCTGTGATGTACCTTTGACTACCCCTTTTGGC
ATGCCGGTTCAAAAGATTAGCATGGGTTTTACTAGAAAAAGCCAAGAAGACTTGATGAAG
TTTTTCAACTGTGTTACTCATAGATTTACTGTGGATTCATATCATATAGTTGACCATAAT
TGCAATAACTTTACAGATGAGGTATTAAGATATCTATTAGATAAAAGAATACCTGAAAAT
ATATCAGGATTACCAAGAGAACTTCTTAATACACCTATAGGTCAGCAGTTTGCCCCTATG
ATTAATTCAATGATGAATATGAAAAATACTATGTTTCCAACAACAATAGTCACTGATCCT
TTTGCTGATTATGTGTCACATGAAGTTTTTTTCCCTGAAATGAAAAAAATCGACTCATAT
CCTGTGTTTGATGAATTTGTGAAAAATGGTGGATTAGTTGGGTATTGGGATCCTAGAATT
GATGAATGCTCTGAACTTGTTGAAATTGTGGGGGGGCTTAAGTGTCGGGTAGGATTTTGT
GATGTGTTGAGATCGTTTTTTTTGGCTCCTGAACAGAAAATTCCATGTTTTAGAGCTTAT
GCAATAGGTGGTGACCTTTTGTGTGAGTATGATTTTGAAACTTTCAAGAATAGTGTTGAG
GAAATCAATGAGTTGATGAATATAAGTTAA