Identifiers and Description

Gene Model Identifier

SteCoe_20625

Standard Name

None

Aliases

None

Description

Asp domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001283203.720075976020836e-44Eukaryotic aspartyl protease f
amily protein
Saccharomyces CerevisiaeYPL154C6.054601895401186e-39Vacuolar aspartyl protease (pr
oteinase A); required for post
translational precursor matura
tion of vacuolar proteinases;
important for protein turnover
after oxidative damage; plays
a protective role in acetic a
cid induced apoptosis; synthes
ized as a zymogen, self-activa
tes
WormBaseWBGene000002176.054601895401186e-39
Oxytricha TrifallaxContig18489.0.g672.6786369618080778e-33Eukaryotic aspartyl protease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20625(Protein)
MALGLVSALVEIPLFPVHKTEEERYAFFKRRQIRHQLNSSPIYVPISNYEDAQYYGPVSL
GTPLQNFQVIFDTGSSNLWVPSHACTAIACKLHNKYNAAASSTYVANGTAFVIQYGSGSV
KGFLSQDVVTWGNAKVNNQTFAEITAESGIAFDAGKFDGILGMAWQSISVDNVVPVFQNL
WAQGSISSNSFAFYLTKQPGQSGSTLTLGGYSDSLSLNDWNYAPLITTDYWRIAIDGIWV
GNNKINFKNIHGIVDSGTSLLVGSLLLADAIKKDVGTVSKDCSNINSLPAVNIQINGKNY
TMNSVDYVLELTSGGQSECINGFDAMVMPAQLSDTLILGDLFIRKFYTLFDFDNKQVGFA
TAI


>SteCoe_20625(CDS)
ATGGCTTTAGGTCTGGTTTCAGCCTTGGTTGAAATTCCCCTCTTCCCTGTTCATAAAACA
GAAGAAGAAAGATACGCTTTTTTCAAAAGGCGTCAAATTCGTCACCAACTAAACAGTAGT
CCAATCTACGTCCCTATTTCTAACTATGAAGATGCTCAATACTATGGTCCAGTCTCCCTC
GGTACTCCTCTTCAGAATTTCCAAGTGATTTTTGACACTGGTAGTTCAAATCTTTGGGTT
CCTTCCCATGCTTGCACAGCCATAGCCTGCAAACTTCATAATAAATACAATGCTGCAGCT
TCCTCAACATACGTAGCCAATGGTACTGCTTTTGTAATCCAATATGGTTCAGGTTCAGTC
AAAGGTTTCCTATCTCAAGATGTTGTAACCTGGGGTAACGCAAAAGTCAATAACCAAACC
TTTGCCGAAATTACAGCTGAAAGCGGTATTGCTTTTGATGCTGGAAAATTCGATGGTATT
CTTGGTATGGCTTGGCAATCAATTTCAGTAGATAATGTTGTCCCTGTCTTCCAAAATCTC
TGGGCTCAAGGATCAATTTCAAGTAACAGTTTTGCATTTTACTTAACTAAACAACCAGGA
CAATCAGGAAGTACTTTAACTCTTGGTGGTTATAGCGATAGTCTATCATTAAATGATTGG
AATTATGCTCCTCTTATTACAACAGACTATTGGAGAATTGCTATAGATGGTATTTGGGTT
GGAAATAATAAGATCAACTTTAAGAATATTCATGGTATTGTTGATAGTGGGACATCTTTA
TTAGTTGGATCTTTATTATTAGCTGATGCTATTAAAAAAGATGTTGGAACTGTTAGTAAA
GACTGTAGTAATATTAACAGCCTACCTGCTGTGAATATTCAGATTAATGGTAAGAATTAT
ACTATGAATTCAGTTGACTATGTACTTGAACTTACATCTGGAGGTCAAAGTGAATGTATT
AATGGATTTGATGCTATGGTTATGCCTGCTCAATTAAGTGATACTTTGATACTTGGTGAT
CTTTTTATTAGAAAGTTCTATACTTTGTTTGACTTCGATAATAAGCAAGTAGGATTCGCT
ACAGCTATTTAG