Identifiers and Description

Gene Model Identifier

SteCoe_20687

Standard Name

None

Aliases

None

Description

tRNA_bind domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005585903.532628572200807e-24TRNA binding domain containing
protein
Oxytricha TrifallaxContig15114.0.g230.000000000000012664165549094176Putative tRNA binding domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20687(Protein)
MMARTTAALDEMIQKLEDRLSLSHPPVSEHSGQHQVEKPLNPPSEPEQIPVAVKCALLTK
PEESKAEDTPQANIPTDTPIKVESKDQQPSSEKPEVSHPVEESKAKTSHDKEEAPVDMSK
APYDLFPQIDIRVGKIVECWKHPSSENLYCEKIDVGEASVREIGSGLQQYVPIADMSGNV
CVMANLRPRKLAGFNSNGMVMALHKVDHGLELVRPGDVPIGERVGLEDMVKPEKSQILAP
LNPKKKVLEKAIAYFGTDAEGYACFGLKKLITSAGFIKTNHPNSRIS


>SteCoe_20687(CDS)
ATGATGGCCAGAACAACTGCAGCACTCGACGAGATGATTCAAAAGCTCGAAGACCGACTA
AGTCTTTCACATCCTCCAGTATCAGAGCATTCTGGCCAGCATCAAGTAGAAAAGCCTTTA
AATCCACCAAGTGAACCTGAGCAAATTCCTGTAGCAGTAAAATGCGCACTATTAACCAAA
CCCGAAGAATCTAAAGCTGAAGATACCCCACAAGCTAATATTCCCACTGATACTCCAATC
AAAGTTGAATCCAAAGACCAACAACCATCTTCAGAAAAGCCTGAAGTTTCTCATCCAGTC
GAAGAATCAAAAGCAAAAACCTCACACGATAAAGAAGAAGCCCCTGTTGATATGTCTAAA
GCTCCTTATGATTTATTCCCTCAAATAGACATTCGTGTTGGAAAAATTGTTGAATGTTGG
AAACATCCATCAAGCGAGAATCTTTACTGTGAAAAAATCGATGTAGGTGAAGCTTCTGTA
AGAGAAATAGGAAGTGGTTTACAACAATATGTACCTATTGCTGATATGAGTGGAAATGTT
TGTGTTATGGCTAATTTAAGACCTAGAAAACTTGCTGGATTTAATTCTAATGGCATGGTT
ATGGCTTTACATAAAGTTGATCATGGGTTAGAATTAGTTAGACCTGGAGATGTACCTATA
GGAGAAAGGGTTGGACTTGAAGATATGGTTAAACCTGAGAAGTCTCAGATACTTGCCCCG
TTAAATCCTAAGAAGAAAGTTTTGGAAAAGGCTATTGCATATTTTGGCACTGATGCTGAA
GGATATGCTTGCTTTGGGCTTAAGAAACTTATCACAAGTGCTGGGTTTATTAAGACAAAT
CACCCTAATTCAAGGATCTCTTAG