Identifiers and Description

Gene Model Identifier

SteCoe_20707

Standard Name

None

Aliases

None

Description

Glycos_transf_4 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • phospho-N-acetylmuramoyl-pentapeptide-transferase activity (IEA) | GO:0008963

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20717.0.g193.817497188671175e-54Glycosyl transferase family 4

Tetrahymena ThermophilaTTHERM_000709901.5400882849875202e-51UDP-N-acetyl-glucosamine-1-P t
ransferase, transfers Glc-Nac-
P from UDP-GlcNac to Dol-P in
the ER in the first step of th
e dolichol pathway of protein
asparagine-linked glycosylatio
n
WormBaseWBGene000133624.4737793061811207e-38
Saccharomyces CerevisiaeYBR243C1.3336148155022614e-34UDP-N-acetyl-glucosamine-1-P t
ransferase; transfers Glc-Nac-
P from UDP-GlcNac to Dol-P in
the ER in the first step of th
e dolichol pathway of protein
asparagine-linked glycosylatio
n; inhibited by tunicamycin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20707(Protein)
MDFFSLIISSCACFPFVFSSYIGFNEWESLIPLMITSFFSFIITLRLIPIIKKTTRAAGL
YGKDLNKNNPKEIPEALGIVPATAYLVTLILTQLFYASDKNSQVQYNSAAFSVCFMIFLG
FADDVLNLRWRYKLLLPTIASFPLIVAYSGTTLIIVPEPLRIYLGKAIELGILYKIYMMM
LAVFCTNAINIYAGVNGIEAGQSLVIASAALTHNFIEIFLHISDDIYKQHLISVSLLLPF
LMSTLALLKYNKYPSKVFVGDTYCYFAGMTFAMAGILGHYSKTMLLFFIPQILNFLISVP
QIFGFFECPRHRLPHYNAKEDILEPVTKHHTLINLILWIIGPTHERELVNILIILQIVSC
GLAFYIRYHVSSLFY


>SteCoe_20707(CDS)
ATGGATTTTTTCAGTCTTATTATCTCATCCTGCGCATGCTTTCCTTTTGTATTCAGTTCT
TATATAGGATTCAATGAATGGGAAAGTCTCATCCCCCTCATGATCACATCTTTCTTTTCT
TTTATCATTACCTTAAGACTAATCCCAATAATCAAAAAAACCACAAGGGCAGCTGGATTA
TATGGAAAAGATCTTAACAAAAACAATCCTAAAGAAATCCCTGAAGCATTAGGAATAGTC
CCAGCCACAGCATATCTTGTTACTTTAATTCTAACTCAGCTTTTCTATGCATCAGATAAA
AATTCACAAGTTCAATACAACTCTGCCGCTTTTTCAGTATGTTTTATGATTTTCTTAGGC
TTTGCAGATGATGTATTGAATCTTCGTTGGAGATATAAACTTTTACTTCCAACAATAGCA
TCTTTTCCTTTAATTGTAGCTTATTCTGGGACAACTTTGATTATTGTTCCAGAACCTTTG
AGGATTTATTTAGGAAAAGCTATAGAACTTGGGATTTTGTATAAAATTTATATGATGATG
CTTGCTGTTTTTTGTACTAATGCAATCAATATTTATGCTGGAGTTAATGGTATTGAAGCT
GGACAAAGTTTAGTTATTGCATCAGCTGCTTTGACTCATAATTTTATTGAAATTTTTTTG
CATATTTCTGATGATATATATAAGCAACATTTGATATCAGTTTCATTATTACTACCATTT
CTTATGAGTACTTTGGCATTATTAAAATATAATAAATATCCGTCAAAAGTTTTTGTTGGG
GACACTTACTGCTATTTTGCTGGTATGACTTTTGCTATGGCAGGTATATTAGGACATTAT
TCGAAAACTATGCTTTTATTTTTCATCCCGCAAATATTAAACTTCCTTATATCTGTTCCT
CAGATTTTTGGGTTTTTTGAATGTCCTCGTCATCGACTTCCTCATTATAACGCTAAAGAG
GATATTCTTGAACCTGTAACTAAACATCATACACTTATAAATCTGATATTATGGATAATT
GGTCCAACACATGAAAGAGAATTGGTTAACATTTTAATTATCCTACAAATCGTGTCATGT
GGCCTTGCATTTTATATCAGATACCATGTTAGTAGTTTATTTTATTAG