Identifiers and Description

Gene Model Identifier

SteCoe_20738

Standard Name

None

Aliases

None

Description

Peptidase_C2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • calcium-dependent cysteine-type endopeptidase activity (IEA) | GO:0004198

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20652.0.g480Calpain family cysteine protea
se

Tetrahymena ThermophilaTTHERM_004869702.2856936767186716e-49Calpain family cysteine protea
se containing protein
WormBaseWBGene000117051.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20738(Protein)
MEAQVISKEIYPGVLVHRQILSDALQEFLVENKRYNTLDFEIDFSGSEGIRIENSHELTI
NLEILPTRTQPIARVITEAKFFINSKFRFNLCPPPADVARQLIAEDSDDILKKLRSSSKI
FKNLPINKVSLDQISSELKGNNFVDPDFSPSDSSIYAGYSISKNELIHWRRPIDIFSDGF
TLFPDEIEPNDIRPGNLENYWFLSALSTLSERPQLVKRLFFNEEVNPDGVYRLRFCKGGE
WVVVTVDDYFPCLPQGNPIYSRSYNNDIWVLLLEKAYAKLHGSYMLLRNGWAHEALLDLT
GCPSENLLFDSKKVRDMIDSNSFWGYLRELDENGALLSACVTEEHFENSGPRHGGLMPGY
SYTILQLRETRNEYLINIRNPWGYFEWEGDWSNKSPLWTPELINSLHPELGEDDGTFWMS
FRDFLNYFNSINICRVKTFYEARVHGKFLRLSIDERSCVISKFYYCLDIPETTKIYIGVH
QEDERVFGADSKRTYLDIGLVIFKRDRGDNPVVYSYKSNENKREIEIEIELQPGSYVILP
RTTGCRLRRPVNAAIEYPSLLLDKQLHPLFLSTIKDIFRKYDIMLKGELGYHEFKNLMET
CSENIIQKDFENIKANFCSTQFGLTQEGLVSYFKDAMSKRGDEKIWEWLLALGYDKDFYS
IKSRVFLLSLHSTCKLKLTVRDAVKSNLDKLATLELLKKYGRKKNDQADVELLSLVEPDA
AAFTYGVFNKLEDKSIKPTLDCSKAKGVLISTMSDIITVTLPPKTGEILAHFVRVDENFD
FRVNFVYTIA


>SteCoe_20738(CDS)
ATGGAAGCTCAAGTTATAAGCAAAGAAATCTACCCAGGAGTTTTAGTCCACCGGCAAATC
CTCTCTGATGCACTACAAGAGTTTTTAGTTGAAAACAAACGTTACAACACCCTTGATTTT
GAAATAGATTTTTCAGGCTCAGAAGGAATTCGTATAGAAAATTCGCATGAGCTCACAATC
AATTTAGAAATCTTACCGACACGTACACAGCCAATAGCTCGAGTTATTACAGAAGCTAAA
TTTTTCATAAATTCTAAATTCCGCTTTAATCTTTGCCCACCTCCCGCTGATGTTGCGCGG
CAATTGATAGCTGAAGACTCAGATGATATCTTAAAAAAACTCAGAAGTTCATCTAAGATA
TTCAAAAACTTGCCAATAAACAAAGTGAGCCTCGATCAAATCTCTTCTGAACTCAAAGGC
AACAACTTTGTTGACCCTGACTTTTCGCCATCAGACTCTTCGATCTATGCCGGCTACTCT
ATATCAAAAAATGAACTAATCCACTGGAGACGGCCAATCGACATATTTAGTGACGGATTT
ACTTTATTCCCTGATGAGATCGAGCCAAACGATATCCGCCCAGGTAACCTCGAGAATTAT
TGGTTTTTATCTGCTTTATCCACATTATCAGAACGTCCTCAGTTGGTAAAAAGACTTTTT
TTTAATGAGGAAGTCAATCCAGATGGAGTCTATCGCTTACGTTTTTGCAAAGGAGGAGAA
TGGGTTGTCGTCACTGTTGATGACTATTTCCCGTGCTTACCTCAAGGAAATCCTATATAC
AGTAGGTCATATAATAATGATATTTGGGTTCTACTGTTAGAAAAAGCTTATGCAAAACTT
CATGGCTCATATATGCTACTGAGAAATGGATGGGCTCATGAAGCACTTTTAGACCTAACT
GGATGCCCTTCAGAGAACCTTTTGTTTGATAGTAAAAAAGTTCGAGATATGATTGATAGT
AACAGTTTTTGGGGTTACTTGAGAGAACTTGATGAAAACGGGGCATTACTTTCAGCTTGT
GTTACTGAAGAGCACTTTGAGAACTCAGGACCTAGACATGGAGGATTGATGCCAGGCTAT
AGTTATACTATATTGCAGCTTAGAGAGACAAGAAATGAGTATTTGATTAATATCAGGAAC
CCTTGGGGATACTTTGAATGGGAAGGTGACTGGAGTAATAAAAGTCCATTATGGACCCCA
GAACTCATCAACAGTCTCCACCCTGAGCTCGGGGAAGATGATGGTACTTTCTGGATGAGC
TTCCGAGACTTTCTCAACTATTTCAATTCAATCAACATCTGCCGGGTGAAAACTTTCTAC
GAAGCTCGTGTACACGGCAAATTCCTTAGACTAAGCATTGACGAACGTAGTTGTGTGATA
TCAAAATTCTATTATTGCCTTGACATCCCTGAGACAACCAAAATCTATATCGGAGTGCAT
CAAGAAGATGAGCGTGTTTTCGGTGCTGATTCTAAAAGAACCTATCTAGATATAGGCCTT
GTAATCTTCAAACGTGACCGAGGGGATAATCCAGTAGTTTATTCATACAAATCCAATGAA
AACAAAAGGGAAATTGAAATTGAAATCGAACTGCAACCTGGAAGTTATGTAATCTTGCCA
AGAACTACTGGGTGCAGATTACGAAGACCAGTAAATGCAGCTATCGAATACCCAAGCCTC
CTACTTGACAAGCAATTGCACCCATTATTTCTTTCTACAATAAAAGACATTTTTAGAAAA
TATGATATTATGCTTAAAGGAGAACTGGGATACCATGAGTTTAAAAATCTAATGGAAACA
TGTTCGGAAAATATCATCCAAAAGGACTTCGAAAATATTAAAGCAAATTTTTGTAGCACA
CAGTTTGGGTTAACTCAAGAAGGACTTGTCAGTTATTTTAAGGATGCTATGAGCAAGAGA
GGAGATGAAAAAATATGGGAGTGGCTTTTAGCCCTAGGATATGATAAGGATTTTTACTCA
ATAAAGTCGAGGGTGTTCTTGCTAAGTTTGCATTCGACTTGCAAACTTAAGCTTACAGTA
AGAGATGCAGTTAAATCTAATTTAGATAAGTTGGCAACACTTGAACTTTTGAAGAAGTAT
GGAAGGAAGAAAAATGATCAAGCTGATGTTGAATTGCTATCGTTAGTTGAGCCTGATGCT
GCAGCTTTTACTTATGGGGTTTTTAATAAGTTGGAAGATAAGAGTATTAAGCCTACTTTG
GATTGCAGTAAGGCTAAAGGTGTACTTATAAGCACTATGAGTGATATAATAACAGTGACT
CTACCTCCAAAGACGGGAGAGATATTGGCTCATTTTGTTAGAGTTGATGAGAATTTTGAT
TTCAGGGTTAATTTTGTCTACACCATAGCTTAG