Identifiers and Description

Gene Model Identifier

SteCoe_20741

Standard Name

None

Aliases

None

Description

Ribosomal_L5e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22366.0.g467.47197233734299e-43Ribosomal L18p/L5e family

Tetrahymena ThermophilaTTHERM_007364804.0795586671775603e-41Ribosomal L18p/L5e family prot
ein
WormBaseWBGene000044168.985825944049381e-37
Saccharomyces CerevisiaeYPL131W3.6251409191435593e-34Ribosomal 60S subunit protein
L5; homologous to mammalian ri
bosomal protein L5 and bacteri
al L18; binds 5S rRNA and is r
equired for 60S subunit assemb
ly

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20741(Protein)
MVFVKVVKNNAYYKRFQVKFRRRREGKTDYRARKFLTFQQKNKYNTPKYRFVVRPTNRNI
IVQVISPSVLGDQIVCHAESKELVNYGLKAGFTNYSAAYATGLLLARRLLAKLKLDTVYQ
GVAKVTGQAFDVYKDMEQRQSNNETINQRPFKAFLDVGLARTTTGNRVFGALKGATDGGM
HIPHSVKRFPGSTKKDGRWKYDAEVHRKRIFGLHVEAYLKKLQTENPEKLKKQFGEWVKS
GAIGKIENLYKGVFEAIRKDPSHKKKARAHAPVKTRVGVNIKTFKGQYARPKKLTSQERK
DRVKQKIVNASAH


>SteCoe_20741(CDS)
ATGGTTTTTGTCAAGGTCGTCAAGAACAACGCCTATTACAAGCGCTTTCAAGTGAAGTTC
CGCAGGCGGAGAGAAGGCAAGACCGACTATCGGGCTCGCAAATTCTTGACATTCCAGCAA
AAAAATAAGTACAACACACCAAAGTACCGATTTGTGGTCAGACCAACCAACCGCAACATA
ATCGTCCAGGTCATCTCCCCATCAGTACTCGGTGATCAAATAGTCTGCCATGCTGAAAGC
AAAGAACTCGTCAATTATGGGCTTAAAGCTGGCTTTACCAATTACTCTGCTGCTTACGCT
ACAGGTTTATTATTAGCCCGAAGATTACTGGCGAAGCTTAAACTTGACACAGTCTACCAA
GGAGTAGCCAAAGTGACAGGACAAGCTTTTGATGTGTATAAGGATATGGAACAAAGGCAG
AGCAACAATGAAACCATAAACCAAAGACCATTTAAAGCATTTTTAGATGTGGGGTTAGCT
AGAACAACTACAGGAAATAGAGTTTTCGGAGCTTTGAAGGGTGCCACTGACGGAGGTATG
CATATTCCTCACTCGGTCAAGAGGTTCCCTGGGAGCACGAAAAAGGATGGTAGATGGAAA
TATGATGCTGAAGTCCATAGAAAGAGGATTTTTGGTTTACATGTTGAGGCTTATTTGAAG
AAACTGCAGACTGAAAACCCAGAAAAACTCAAGAAGCAGTTTGGGGAATGGGTGAAAAGT
GGAGCGATTGGGAAAATTGAGAACTTGTATAAGGGAGTTTTTGAGGCTATAAGGAAAGAC
CCAAGTCATAAGAAAAAAGCTAGAGCTCATGCACCAGTGAAGACTAGAGTTGGAGTGAAT
ATTAAGACATTCAAAGGTCAGTACGCAAGACCTAAGAAGCTTACTAGCCAGGAGAGGAAA
GATAGGGTTAAGCAAAAGATTGTTAATGCTTCAGCTCATTAG