Identifiers and Description

Gene Model Identifier

SteCoe_20761

Standard Name

None

Aliases

None

Description

Mito_carr domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13881.0.g751.6458114310822737e-38Mitochondrial carrier protein

Tetrahymena ThermophilaTTHERM_005307303.3057006267607343e-37Mitochondrial carrier protein
Saccharomyces CerevisiaeYMR166C3.1391327920480296e-17Predicted transporter of the m
itochondrial inner membrane; h
as similarity to human mitocho
ndrial ATP-Mg/Pi carriers; YMR
166C is not an essential gene
WormBaseWBGene000122040.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_20761(Protein)
MEEQYPIVLTSISAFISGGIARMVVHPLDTIKAKLQVQQGNKSPEFLTITQAFKTTLAKE
GYKGLYKGLTFSAFGCLPAVCLYFTSYELSKKYLLEIPAFKNNNFLAYLTSGMIAEAISC
MFFVPIDVIKERLQVQSNLKEYNYANGRNALKILLSKEGLRGIYRAYGATVASFGPFSGL
YFLFYEYSKHYFVGGHKEISFFHSVLCAGFAGSLSAWITNPLDIAKVRMQVVRAIGKSKF
PYKNMFHGIYLIASEEGFRALFQGSLARILFHTPNTAISMSLVEFFRRLLSNDI


>SteCoe_20761(CDS)
ATGGAAGAACAGTATCCGATTGTTTTAACATCAATTTCAGCATTTATAAGTGGGGGAATA
GCTAGAATGGTTGTCCATCCTTTAGATACAATAAAAGCTAAACTTCAAGTACAACAAGGA
AATAAAAGTCCTGAGTTCCTGACAATAACTCAAGCTTTTAAAACAACTTTAGCTAAAGAA
GGCTATAAAGGTTTATATAAAGGGTTAACATTCTCTGCATTTGGATGTTTGCCAGCAGTT
TGTTTATATTTTACATCATATGAACTTAGTAAGAAGTATCTTTTAGAGATCCCTGCTTTT
AAAAATAACAATTTTTTAGCATATTTAACCTCAGGAATGATAGCAGAAGCTATAAGCTGT
ATGTTTTTTGTTCCAATCGATGTTATTAAAGAGCGTTTGCAAGTTCAATCAAATCTTAAA
GAATACAATTATGCAAATGGAAGAAATGCTTTAAAAATCCTTTTATCCAAAGAAGGCCTT
AGAGGAATTTACCGTGCGTATGGGGCAACCGTAGCTTCATTTGGTCCTTTTAGCGGGCTT
TATTTCCTTTTTTATGAATACAGCAAGCATTATTTTGTTGGTGGACATAAAGAGATCAGT
TTTTTTCATAGTGTTCTTTGTGCTGGATTCGCTGGATCACTTTCTGCTTGGATAACAAAC
CCATTAGATATAGCCAAAGTTCGTATGCAAGTTGTCAGAGCGATAGGAAAATCTAAATTC
CCATATAAAAACATGTTCCATGGCATATATCTTATTGCTAGTGAAGAAGGGTTTAGGGCA
CTTTTTCAAGGGTCTCTAGCAAGAATATTGTTTCATACACCAAATACAGCTATAAGTATG
AGTTTAGTGGAGTTTTTTAGAAGATTATTAAGTAATGATATATAA