Identifiers and Description

Gene Model Identifier

SteCoe_2079

Standard Name

None

Aliases

None

Description

zf-HC5HC2H_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20227.0.g471.2479464629129513e-47SET domain

Tetrahymena ThermophilaTTHERM_002394007.47197233734299e-43SET domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2079(Protein)
MQKVICGTCGVGLYSDLKLTEWKCSPCSKGISPSSLKCIACALSNGVFLKTDSRKWLHLF
CALLLKPYIKSTQEIKLAKNALNCTVSVKIPQSLYQSPCVFCKSPNKSAAITCYICKESM
HISCVVNKTWKIVGENFDCGCSEKRKGIKKLKNQELPPVRGPKSCLILEHIMERIIKADF
LMIFRKNCEALQVPNKDSLLNALTAGFYIDFADEHLSIVIKKQEDQPCKKHKLTTPHNIL
HFDDISDVVSEGEPKYVDDYRQYEDKMLTNLDFIYNYYIRGHAYFSMSQVQKDLRKMILS
KLHSAKTEGEKIYINNFWNIVIQHLKKNKKKFEDAVIEDWRVCLENNDGAPKVTSVWHKE
AFESREYIMINDYKEVSDGTNKRLLTKKKGNCNGQACEDLADLGPFELINSTWTSENSDR
AKRVECSENCECLEPSCKNRQIGLKQIQKLEQDVKEVPTWGFDVYTYRNIMAYIRHPVGQ
KMHKFISKALSKAINSVKCDNWNLLKALEYIINDTNQVFKLRDKRYADGLHNAIIGLSEI
MSQDIVLNEFRIHPKGTGVICLNPIGIPKNSLIIEYFGELYSPAKWYEKQDLIKSLTNQI
KKKDSTVETLPDFYNIMLERHHDDPEGYDVLIVDPIFYGSYGSRLSHSCTPNCGTVTMVA
DGKYSIGMYALNDIKYLDELTFDYNSITESREEHLNAVCLCASSVCRSYYLAHAQNSSNI
PSFHNFLHRASLMLHASINKFNAIDQAICDKFCIKSCVLNECPNWLKVWISLVLLVVEKE
ADGISLEIYKKITIDSRLQNLVMTVDKVKYCMKQSSDHEPYHLLSPAEVQDYFWGTHENS
VRQQLKNLFSSLKLDCPLLNKNLTSTIETRLQLLKIRDFLRISFPNQWKGAGIADMLHLI
AYTRVFFTELCYASFESSPVKIRHCEIAKIPSKPGDFKELRKKYSSFHIQGTLCGWYKQT
VEKPAASLSADKRGTLSLACIEIPIEGDYSAKLRKILIDHIREKPHSTWPSRPNVKYPWG
NFTNKAKVLGSPMFDIAFFEDCSMLSRALDCLDLPADKCQIVSTYYKNTV


>SteCoe_2079(CDS)
ATGCAAAAAGTAATATGCGGGACATGCGGTGTTGGCCTCTATAGCGATCTAAAACTCACA
GAATGGAAATGCAGTCCTTGCAGCAAAGGTATATCCCCAAGTTCTCTCAAATGCATTGCC
TGTGCTCTTTCCAATGGGGTGTTCCTAAAAACAGACTCTAGAAAATGGCTTCATTTATTC
TGTGCACTTTTATTAAAACCCTATATCAAATCAACACAAGAGATAAAATTAGCTAAAAAC
GCTCTGAATTGTACTGTTTCAGTCAAAATCCCACAATCCTTATATCAAAGTCCATGTGTA
TTTTGTAAGTCCCCCAATAAAAGTGCAGCTATTACTTGTTATATATGCAAAGAAAGCATG
CACATATCATGCGTTGTTAATAAAACCTGGAAAATTGTTGGGGAAAACTTTGATTGTGGA
TGCTCGGAAAAACGTAAGGGGATTAAAAAATTAAAAAATCAAGAGTTGCCTCCAGTTAGA
GGGCCGAAGTCATGCTTGATATTAGAACATATAATGGAAAGGATAATTAAAGCAGATTTT
TTGATGATTTTCAGAAAAAATTGTGAGGCTTTGCAGGTTCCAAATAAGGATAGCTTGTTG
AATGCTTTGACTGCTGGCTTTTATATAGACTTTGCTGATGAGCATTTGTCGATTGTTATT
AAAAAACAAGAGGACCAGCCTTGTAAAAAACACAAACTCACAACGCCGCATAATATTTTG
CATTTTGATGATATATCTGATGTTGTTAGTGAGGGTGAGCCAAAATATGTTGATGACTAT
AGACAGTATGAAGATAAAATGCTCACGAATTTAGATTTTATATATAATTATTACATTCGA
GGTCATGCGTATTTTTCAATGTCTCAAGTGCAAAAGGATCTAAGGAAAATGATCCTAAGC
AAATTGCACTCCGCTAAGACTGAAGGTGAGAAAATCTACATAAACAACTTTTGGAATATA
GTTATACAGCATCTGAAAAAAAATAAAAAAAAATTTGAAGATGCAGTTATTGAAGATTGG
AGAGTTTGCTTAGAAAACAATGATGGAGCACCTAAAGTTACATCAGTTTGGCACAAAGAA
GCATTTGAAAGCAGAGAATATATAATGATAAATGATTACAAAGAAGTATCGGATGGGACT
AATAAGAGGTTGCTAACTAAGAAAAAAGGGAATTGCAATGGCCAAGCTTGTGAAGATTTA
GCTGATTTGGGTCCTTTTGAATTAATTAATAGTACATGGACAAGCGAAAACTCAGATAGA
GCGAAAAGGGTAGAGTGCAGTGAAAATTGTGAATGTCTTGAACCGTCCTGTAAGAACCGA
CAAATTGGACTTAAACAGATCCAAAAGCTTGAGCAAGATGTCAAAGAAGTACCAACTTGG
GGTTTTGATGTATATACATATAGAAACATAATGGCTTATATCCGCCATCCAGTAGGACAA
AAAATGCATAAGTTTATATCAAAAGCTTTATCTAAAGCTATAAACTCAGTGAAATGCGAC
AATTGGAATCTATTAAAAGCTTTAGAGTATATAATAAATGATACAAACCAAGTGTTCAAA
CTAAGAGACAAAAGATATGCTGATGGACTACATAATGCTATTATAGGGCTCAGTGAAATT
ATGAGTCAAGATATTGTTCTTAATGAATTTAGGATACACCCAAAAGGTACAGGGGTCATA
TGCTTAAACCCAATAGGAATACCTAAGAATTCTTTAATAATCGAGTATTTTGGGGAGCTT
TATTCTCCAGCTAAATGGTATGAAAAGCAAGATCTTATAAAAAGTTTGACTAATCAAATA
AAGAAAAAAGACAGCACAGTAGAAACATTGCCTGATTTTTATAATATAATGCTAGAAAGG
CATCATGATGATCCAGAAGGGTATGATGTACTTATTGTAGATCCTATTTTCTATGGGAGT
TATGGAAGTAGGCTAAGTCATTCGTGCACACCCAATTGCGGCACTGTGACAATGGTTGCT
GATGGCAAGTATTCTATAGGAATGTATGCATTAAATGACATAAAGTATTTAGATGAGCTA
ACTTTTGACTATAATTCTATAACAGAAAGCCGTGAAGAACATTTGAATGCTGTTTGCTTA
TGTGCGTCATCAGTTTGTAGGAGTTATTATCTTGCCCATGCTCAGAATTCAAGTAATATC
CCGAGTTTTCATAACTTTTTACATAGAGCTTCTCTTATGCTTCATGCAAGTATTAATAAG
TTTAATGCTATTGACCAGGCCATTTGTGATAAGTTTTGTATAAAAAGTTGTGTGCTTAAT
GAGTGTCCGAATTGGCTTAAAGTATGGATTTCGTTGGTGCTATTAGTGGTTGAGAAAGAG
GCTGATGGGATAAGTTTGGAGATTTATAAGAAGATTACAATTGATTCGAGGTTGCAGAAT
TTGGTTATGACTGTAGATAAGGTTAAGTATTGTATGAAGCAGAGTAGTGACCATGAACCG
TATCATTTGTTAAGCCCAGCTGAGGTACAGGACTACTTTTGGGGTACTCATGAGAATTCA
GTCCGCCAGCAACTAAAAAATCTTTTCAGCTCCTTAAAACTCGATTGCCCCCTCCTGAAC
AAAAACCTCACATCCACAATCGAAACCCGTCTTCAGCTTCTAAAAATCAGAGATTTCCTC
CGTATCTCATTCCCAAATCAATGGAAAGGGGCGGGTATAGCTGACATGCTTCATCTCATC
GCTTACACCCGAGTGTTCTTTACTGAACTCTGTTACGCCTCATTTGAATCCTCCCCAGTC
AAAATCCGTCATTGTGAAATCGCTAAAATCCCATCAAAGCCCGGGGATTTCAAAGAACTA
AGAAAAAAATACTCATCTTTTCATATACAAGGCACTTTATGTGGCTGGTATAAACAAACA
GTCGAAAAACCAGCAGCCTCATTATCAGCTGATAAAAGAGGAACTCTATCTTTGGCATGC
ATAGAAATCCCAATTGAAGGAGATTATTCAGCAAAACTAAGGAAAATTCTTATTGATCAT
ATAAGAGAAAAGCCTCATTCAACCTGGCCTTCAAGACCTAATGTAAAATATCCATGGGGT
AATTTCACTAATAAAGCTAAAGTCTTGGGATCTCCGATGTTTGATATAGCTTTTTTCGAA
GATTGTTCAATGCTTTCAAGAGCTTTAGACTGCTTAGATTTGCCTGCTGACAAATGCCAG
ATTGTCAGTACTTATTATAAAAATACGGTTTAA