Identifiers and Description

Gene Model Identifier

SteCoe_21012

Standard Name

None

Aliases

None

Description

Kinesin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3710.0.g723.4811068399043105e-57Kinesin motor domain

Tetrahymena ThermophilaTTHERM_000149201.6889118802245324e-48Kinesin-like protein; contains
a C-terminal motor domain

Saccharomyces CerevisiaeYPR141C5.380186160021138e-32Minus-end-directed microtubule
motor; functions in mitosis a
nd meiosis, localizes to the s
pindle pole body and localizat
ion is dependent on functional
Cik1p, required for nuclear f
usion during mating; potential
Cdc28p substrate
WormBaseWBGene000022161.0806392777072785e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21012(Protein)
MSNSVAPESSDRPPPALHMPEEKKSLSEQLLAELTPKISVNEELPSRMHVNEFTPGEIIG
NESLNKLPPLKGKEAAFIPLHLARDYVKKMENDMKNMHNHYKEMLLDLDKSYAGIEQDLH
KKYKDFIDKYKGQMDKKCKSLKSAYEEEHKLREELRTWAEVNMIALQEKVKDLTDDKKKS
IERLEAVMAGGGKEMDNLKKALESEYSGKIERAKSEKGKIEADLIAIQKESKSRNLDVAR
LALEVIIQKAEHIIEKGISKFDPKPAEKQIIVPINKIPEENKVSSSVHKVPEEHKINKGP
DPEIEKLKDQNKKYKKEIQELKVSLANRPVPIGPDPELVKENDLLKQQLEAKILKHKKVM
AEIEAERNSLKNEVKIFTSNLSAPSSSDDEEKTALKTQLALLATEMAVSRDRATVLEGQS
SQITPLQQSLKEKEQEIADLHQKLAAKPQVSHVSQVVAVDISGQLEAKDERIDRLNEEIA
KLKVKIDEFTAIPASAVAPSPKDDKEKKELKALLGKQQKRNEMLKEENEKLKNTLVDPEE
IVRIKAHLEAANEQIFELQNTIERQAQVPVKVKKSKVQEPTHIPVPVISNVEPKRKKTPT
NDLFEDDNEEELIQLREKLTITNQEVTFLKSQLQSSGKPAEAFPTEELAKLNHDLSEANR
KINHLNQELSNRPVSKGNSEKLLAEITLLKSENTGLKANDKSGEISKLSTTLKALQQELD
NRPTDNDISKLNDIIKSQEKQIKDSSSSQGQQLKNLNDQMASMKSAHDAENKDKDTKYEK
IAKESADAMNKLNKQIADLEKIRENLEKTLKDEKDSKAKVLAELDQVKKVAGEVMGLTKK
VEELTAIVATLQEKNTAKEQELKDSLRQRKLLHNQLEDLKGKIRVFCRVRPLGRSELERG
CVNITTVVDEFTITCDSKNGVKPFVYDAVFGPNNTQFEIFEDTKRSIQSAIDGYNVCVFA
YGQTGSGKTYTMQGESSNPGIIPRAMEELFNVLNGMPGHYKWEVSCYMVELYLDTLIDLF
LGKDFKGTPSSLSIKKDIKGIVTVPEATLYKVKSSSEIMQKFDYGNTMRHTSSTKMNDTS
SRSHLIFSVMIDVTNTETNQRTVGKLSLVDLAGSERVSKTEATAERLKEGRAINKSLSAL
GDVISALSSNESHIPYRNNKLTMLMSDSLGGTAKTLMFVNVSPADYNQEETTMSLYYAAR
VKLITNDPSKNIESKEMSNVKSELLMITSERDKYKTALEKSGINIGNLDSILESRNEDFD
DPKYDDL


>SteCoe_21012(CDS)
ATGTCTAATTCTGTTGCACCAGAATCATCAGATAGGCCTCCACCTGCACTTCATATGCCT
GAAGAGAAAAAGTCGTTATCTGAACAGCTTTTAGCAGAGCTTACCCCCAAAATTTCAGTT
AATGAAGAACTTCCTTCAAGAATGCATGTGAATGAATTCACTCCGGGTGAAATCATTGGA
AACGAGTCTTTGAATAAACTTCCTCCACTAAAAGGAAAAGAAGCAGCTTTTATACCTTTA
CACCTTGCCAGAGATTATGTTAAGAAGATGGAAAACGATATGAAAAACATGCATAACCAT
TACAAAGAAATGTTACTAGATCTTGACAAATCATATGCCGGTATCGAGCAAGACCTCCAT
AAAAAATACAAAGACTTCATAGATAAATACAAGGGCCAAATGGATAAAAAATGTAAAAGC
TTGAAATCAGCTTACGAAGAAGAACATAAATTAAGAGAAGAACTACGAACTTGGGCTGAA
GTAAACATGATTGCCCTTCAAGAAAAAGTTAAAGACTTAACAGATGATAAAAAAAAGTCC
ATAGAAAGACTTGAAGCTGTTATGGCAGGGGGAGGCAAAGAAATGGACAATTTAAAAAAA
GCTCTAGAATCTGAATACTCAGGAAAAATCGAAAGAGCCAAAAGCGAAAAAGGTAAAATT
GAAGCTGATTTAATTGCCATTCAAAAAGAATCTAAATCTCGAAATTTAGATGTGGCAAGA
CTAGCTTTAGAAGTTATAATCCAAAAAGCAGAACACATTATCGAAAAAGGAATCTCTAAA
TTTGATCCTAAACCTGCTGAAAAGCAAATAATAGTCCCAATAAATAAAATTCCAGAAGAA
AATAAAGTATCAAGTTCAGTACATAAAGTTCCAGAAGAACATAAAATTAATAAAGGTCCT
GATCCAGAAATTGAAAAACTTAAAGACCAAAATAAAAAGTATAAAAAAGAAATCCAAGAA
CTTAAAGTTTCTTTAGCAAATCGACCTGTTCCTATTGGTCCTGATCCAGAACTTGTAAAA
GAAAATGATTTATTAAAACAACAACTTGAAGCTAAAATACTCAAACACAAAAAAGTTATG
GCTGAAATAGAAGCTGAGCGTAACAGTTTAAAAAATGAAGTTAAAATTTTCACTTCAAAT
CTTTCTGCACCTTCTTCTTCTGATGATGAAGAAAAAACAGCTTTGAAAACTCAATTAGCT
TTATTAGCTACAGAAATGGCTGTATCTCGAGATAGAGCTACAGTATTAGAAGGTCAGTCA
TCACAAATTACCCCACTTCAACAAAGTCTTAAAGAAAAAGAACAAGAAATCGCTGATTTA
CATCAGAAACTAGCGGCAAAACCACAAGTTTCACATGTTTCACAAGTTGTAGCTGTTGAT
ATATCAGGACAACTTGAAGCTAAAGATGAGAGAATTGATAGATTAAATGAAGAAATCGCT
AAACTTAAAGTAAAAATTGATGAATTTACAGCGATACCTGCTTCTGCTGTAGCTCCTAGT
CCTAAAGATGATAAAGAAAAGAAAGAACTTAAAGCTTTATTAGGTAAGCAACAGAAACGT
AATGAAATGCTTAAAGAGGAAAATGAAAAACTTAAAAACACTTTAGTCGACCCTGAAGAA
ATTGTTAGGATTAAAGCTCATTTAGAAGCAGCGAATGAACAAATTTTTGAATTGCAAAAC
ACTATAGAAAGACAAGCACAAGTTCCAGTTAAAGTTAAAAAATCTAAAGTTCAAGAACCT
ACTCATATTCCTGTTCCTGTTATAAGTAATGTTGAACCTAAAAGAAAAAAAACCCCAACT
AATGATTTATTTGAAGATGATAATGAAGAAGAATTAATACAATTACGAGAAAAACTTACT
ATAACCAATCAGGAAGTCACATTTTTAAAGTCGCAATTGCAAAGCTCTGGCAAACCTGCA
GAAGCTTTTCCAACAGAAGAATTAGCTAAACTGAATCATGATTTATCAGAAGCTAATCGT
AAAATTAATCATTTAAATCAAGAACTTAGCAATCGTCCTGTTTCTAAAGGAAACTCTGAA
AAACTCCTTGCTGAAATCACTTTGCTTAAATCTGAAAACACAGGTCTTAAAGCTAATGAT
AAAAGTGGAGAAATAAGTAAACTTAGTACTACACTTAAAGCTTTACAACAAGAACTTGAT
AATAGACCTACAGATAATGATATTTCTAAGCTTAATGATATTATTAAATCTCAAGAAAAA
CAAATAAAAGATTCAAGTTCTTCTCAAGGACAACAACTTAAGAATCTTAATGATCAGATG
GCTTCAATGAAATCAGCTCATGATGCAGAAAATAAAGATAAAGATACGAAATATGAAAAA
ATAGCTAAAGAATCAGCTGATGCTATGAATAAACTTAATAAACAAATTGCAGATCTTGAG
AAAATACGTGAGAATCTTGAAAAAACTTTAAAAGATGAGAAAGACTCAAAAGCAAAAGTT
TTAGCTGAATTGGATCAGGTGAAAAAAGTTGCAGGAGAAGTTATGGGGCTGACTAAAAAG
GTAGAAGAACTCACAGCTATTGTTGCGACTTTACAAGAAAAAAATACAGCTAAAGAGCAG
GAACTTAAAGATTCTTTGAGACAAAGAAAATTGCTCCATAATCAATTAGAAGATTTGAAA
GGAAAAATCAGAGTTTTTTGCAGAGTTAGGCCTTTGGGAAGAAGTGAATTAGAAAGAGGT
TGTGTGAACATCACTACTGTCGTTGATGAATTCACAATTACTTGCGACTCCAAAAACGGA
GTCAAACCTTTTGTTTACGATGCCGTATTTGGTCCAAACAACACCCAATTTGAAATTTTT
GAAGATACTAAAAGATCTATACAAAGTGCTATTGATGGTTATAATGTTTGTGTTTTTGCT
TATGGACAGACAGGTTCAGGTAAAACATACACAATGCAAGGTGAATCAAGTAACCCTGGT
ATAATTCCAAGAGCAATGGAAGAATTATTCAATGTATTAAATGGTATGCCAGGACATTAT
AAATGGGAAGTAAGTTGTTATATGGTTGAGCTTTATTTAGATACTCTTATAGACTTGTTT
TTAGGAAAAGATTTCAAAGGAACACCTTCTTCATTAAGTATTAAAAAAGATATCAAAGGT
ATTGTAACAGTCCCTGAAGCTACATTATATAAAGTTAAATCATCCAGTGAAATAATGCAG
AAATTTGATTATGGGAATACTATGAGGCATACAAGTAGTACAAAAATGAATGACACATCT
TCAAGATCTCATTTGATTTTCAGTGTTATGATTGATGTGACAAATACTGAGACAAATCAA
AGAACTGTAGGAAAACTAAGCCTTGTTGACTTGGCTGGGTCTGAAAGAGTTTCAAAAACT
GAGGCTACAGCTGAAAGGCTTAAAGAAGGAAGAGCTATTAATAAAAGTCTCTCAGCATTG
GGTGATGTCATTTCAGCTTTATCTTCAAATGAATCACATATTCCATATAGAAATAATAAA
CTTACAATGCTTATGAGTGATTCTTTAGGAGGTACAGCTAAAACTCTTATGTTTGTTAAT
GTTTCACCAGCTGATTATAATCAAGAAGAAACAACTATGTCACTTTATTATGCAGCAAGA
GTTAAACTTATTACTAATGATCCTAGTAAAAATATTGAATCTAAAGAAATGTCTAATGTT
AAAAGCGAATTATTGATGATTACTAGTGAAAGAGATAAATATAAAACTGCTTTAGAAAAG
AGTGGAATTAATATTGGAAATTTAGACTCGATACTTGAAAGTAGGAATGAAGATTTTGAT
GACCCCAAATATGATGATCTTTAA