Identifiers and Description

Gene Model Identifier

SteCoe_21077

Standard Name

None

Aliases

None

Description

RNB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19321.0.g574.961148436415422e-78RNB domain

Saccharomyces CerevisiaeYOL021C3.5722699376192174e-67Exosome core complex catalytic
subunit; has both endonucleas
e and 3'-5' exonuclease activi
ty; involved in 3'-5' RNA proc
essing and degradation in both
the nucleus and the cytoplasm
; role in degradation of tRNAs
; has similarity to E. coli RN
ase R and to human DIS3; mutat
ions in Dis3p corresponding to
human mutations implicated in
multiple myeloma cause phenot
ypes suggesting impaired exoso
me function; protein abundance
increases in response to DNA
replication stress
WormBaseWBGene000010015.301718666092324e-65

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21077(Protein)
MEPVIVSVPKKSRRGNIFNSVRCNYLRNDLPCYHSACNYCMSSFAPLKSETIYILSFDSL
LTYFSFLENQDFLAPSNTVFPQSSFVHMKKLDLKLYDKMKIFIEDKQYAVFPNEHHKETY
VPINTPNRANIAVEVLKGYYSKHLPDINVVVISNNLEAILAGSPLLDKLPVVISDGPALF
PDHISYDQAFTLIKQGDLYEGVFHVLREDRGKAWVSINKGVRAELQVSVEGKAGNRAIDG
DIVAVKIIGGMEVEDKIELDEGVDVVVTGKKTQKVLPSIQAEVVCIIKHKYKHYCGSIRR
TGFIHNNKEICMFSPINPKIPEIQLLCLFPHLLEDKRISVEISSWPAHSEHPIGHMVRII
GNITDLATESEVILLEHDVIIKPFTQAALNCLPAKDWTIPQEEEKSRLNLRDRCVASVDP
PGCKDIDDALHCSLLANGNYEIGVHIADVTYFVKANSSLDLEASERCTTVYLVEKRTDML
PGVLTEVLCSLVSNQDRLAFSVIWEIDPKTARIINTQFGKSIIHSRASLSYKTAQDLINA
NKPDELTQSLKRLMHISKLLRQQRIDEGALELASTEVKFELDTEKQGKDIALYQTYETNS
MVEEFMLLANVAVGRKIVDTYPAYSILRRHPPPKYPELGVLASKLQKLNYSLLYSTSSEL
SSSLNHIKSSDHYLNTIVRMQVTRCMNQAVYFCSSEFDRLEYHHYGLAAQIYTHFTSPIR
RYADILVHRLLSASIDVESLPDSMTDRRIMQKICRRMNFRNRMSQFAERTSANLHTYLVF
KNRGSSEEEAIVTDILEFGVNVMIPKIGLEGAIDLPGNISEDGISWIMDDKRILLYSHLL
VKIEISFEHFRKTINLKLLKTI


>SteCoe_21077(CDS)
ATGGAGCCTGTTATAGTCTCAGTGCCTAAAAAATCACGTCGTGGGAACATTTTCAACAGT
GTGCGTTGCAACTATTTGCGTAATGACCTTCCATGCTATCATTCAGCATGTAATTACTGC
ATGAGTTCATTTGCTCCTTTGAAAAGCGAGACCATTTACATCCTTAGCTTTGACTCTCTA
TTAACCTACTTCTCATTTCTTGAAAACCAAGACTTCCTGGCTCCATCCAACACAGTTTTT
CCACAATCATCCTTTGTCCATATGAAAAAACTAGACTTGAAGCTTTACGATAAAATGAAA
ATTTTCATTGAAGACAAACAATATGCAGTATTTCCAAATGAACATCATAAAGAAACATAT
GTGCCGATAAATACACCAAACAGAGCTAATATAGCAGTAGAAGTTCTAAAAGGTTATTAT
TCTAAGCATTTGCCTGATATTAATGTTGTAGTGATATCAAACAACCTTGAAGCTATTCTT
GCTGGGTCTCCACTTTTGGATAAACTTCCTGTAGTAATCTCAGATGGTCCAGCCTTGTTT
CCAGACCATATTTCATATGATCAAGCATTTACTTTAATCAAACAAGGGGATCTTTACGAA
GGAGTATTTCATGTTTTAAGAGAAGATAGAGGGAAAGCATGGGTTTCTATAAACAAAGGG
GTTAGGGCTGAACTTCAAGTAAGTGTTGAAGGTAAAGCAGGGAATAGAGCAATAGACGGT
GATATAGTGGCCGTAAAAATCATAGGCGGGATGGAAGTTGAAGATAAAATCGAACTTGAC
GAAGGAGTTGATGTTGTGGTAACAGGAAAAAAAACTCAAAAAGTCCTGCCAAGCATCCAA
GCTGAAGTTGTCTGCATAATCAAACATAAATACAAGCACTACTGCGGCAGCATTCGTCGT
ACAGGCTTTATTCACAACAACAAAGAAATCTGCATGTTCTCTCCAATAAATCCCAAAATC
CCTGAAATTCAACTTCTCTGTTTATTCCCCCACCTTCTTGAAGATAAACGTATATCAGTA
GAAATCTCCTCATGGCCAGCTCATAGTGAACATCCAATAGGCCATATGGTTCGTATAATT
GGCAATATAACTGACTTAGCAACAGAAAGTGAAGTTATCCTTCTAGAACATGATGTTATA
ATCAAACCATTTACTCAAGCTGCATTAAATTGCTTACCGGCTAAAGATTGGACTATTCCT
CAAGAAGAAGAAAAATCTAGGTTAAATTTAAGAGACAGATGTGTTGCCAGTGTTGATCCA
CCCGGATGTAAAGATATTGATGATGCTTTACATTGTAGTTTGTTAGCTAATGGGAATTAT
GAAATAGGTGTGCATATTGCTGATGTGACATATTTTGTTAAAGCAAATTCATCTTTAGAT
TTAGAAGCCTCTGAAAGATGTACAACTGTTTATTTGGTAGAAAAACGTACAGATATGCTT
CCTGGAGTTTTAACTGAAGTGTTATGCAGTCTTGTAAGTAACCAAGACCGTTTAGCTTTT
TCTGTAATATGGGAAATTGACCCTAAGACCGCTAGGATTATCAACACGCAGTTTGGTAAA
AGTATTATTCATTCAAGAGCTAGTTTATCTTATAAAACAGCACAAGATCTTATAAACGCT
AATAAACCTGATGAATTAACTCAGTCATTAAAAAGACTTATGCATATATCGAAGCTTTTA
AGACAGCAGCGTATTGACGAAGGGGCTCTTGAGTTAGCTAGTACTGAAGTTAAATTTGAG
TTAGATACAGAAAAACAAGGTAAAGATATTGCCCTATATCAAACATATGAGACTAATAGC
ATGGTTGAAGAGTTCATGCTTCTTGCTAATGTTGCTGTAGGTAGAAAAATTGTAGACACT
TACCCTGCGTATAGTATCCTTAGAAGACATCCTCCACCTAAATATCCTGAACTTGGTGTA
TTAGCAAGTAAACTGCAAAAACTTAATTATTCGTTGTTGTACTCAACATCTTCAGAGCTT
TCATCAAGTCTTAATCATATAAAAAGCTCAGATCACTATCTTAACACTATAGTCCGCATG
CAGGTTACAAGGTGTATGAATCAAGCTGTTTATTTCTGCTCAAGTGAATTTGATAGACTT
GAATATCATCATTATGGTTTAGCTGCTCAAATTTATACTCATTTCACAAGTCCAATTCGT
CGTTATGCTGACATTTTAGTGCACAGGCTTCTTTCAGCTTCAATAGATGTTGAGTCTTTA
CCAGATAGTATGACTGATAGGAGGATCATGCAGAAAATCTGTAGAAGGATGAACTTCAGA
AATCGTATGTCGCAGTTCGCTGAAAGGACTTCAGCCAACCTTCACACTTACCTAGTCTTT
AAAAACCGAGGTAGTTCTGAAGAGGAAGCTATAGTTACAGACATCCTAGAGTTCGGAGTA
AATGTCATGATCCCAAAAATCGGCCTTGAAGGAGCTATAGACCTCCCTGGGAATATATCA
GAAGATGGGATTTCTTGGATAATGGACGACAAGCGAATCCTCCTCTATTCTCACCTTCTC
GTGAAAATCGAAATATCCTTTGAGCATTTCCGGAAGACCATAAACCTAAAACTCTTAAAA
ACTATTTAG