Identifiers and Description

Gene Model Identifier

SteCoe_2117

Standard Name

None

Aliases

None

Description

AhpC-TSA domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_011948303.0144087850653746e-40AhpC/TSA family protein
Oxytricha TrifallaxContig4282.0.g503.0144087850653746e-40AhpC/TSA family

WormBaseWBGene000064347.281290178321643e-33
Saccharomyces CerevisiaeYML028W8.75651076269652e-27Thioredoxin peroxidase; acts a
s both ribosome-associated and
free cytoplasmic antioxidant;
self-associates to form high-
molecular weight chaperone com
plex under oxidative stress; c
haperone activity essential fo
r growth in zinc deficiency; r
equired for telomere length ma
intenance; protein abundance i
ncreases, forms cytoplasmic fo
ci during DNA replication stre
ss; TSA1 has a paralog, TSA2,
that arose from the whole geno
me duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2117(Protein)
MASYTSKAVIRKPAPAFTAAAWDGNRMRNVSLSDYRGKYVVLFFYPLDFTFVCPTEICNF
NDLAPEFRAVECEVLACSVDSIFSHREYTLKSRDNGGLGKMQIPIIADLNKQIGKDYGVY
LDHSDDEGVHLRGTFIIDRDGVLRHISINDLPVGRNSKEILRLVKAFQYTDVYGEVCPES
WQPGSATMVPDHESEKLGDFWKNQHGKAT


>SteCoe_2117(CDS)
ATGGCTAGCTACACCTCCAAAGCAGTGATAAGGAAACCAGCCCCAGCTTTCACAGCTGCA
GCATGGGACGGAAACAGAATGAGGAATGTAAGCCTTTCTGATTACCGTGGAAAATATGTT
GTGCTTTTCTTTTACCCTCTGGACTTTACCTTTGTTTGCCCGACTGAAATTTGCAATTTC
AACGACTTAGCCCCTGAGTTCAGAGCTGTTGAGTGTGAAGTGCTAGCCTGCTCTGTTGAT
TCTATATTCTCACATAGAGAATACACCTTGAAATCTCGTGATAATGGTGGTCTTGGCAAA
ATGCAAATCCCAATCATTGCTGACTTGAACAAGCAGATTGGCAAAGATTATGGTGTATAT
CTTGATCATTCTGATGATGAGGGAGTACATCTTCGTGGAACTTTTATTATTGATAGAGAT
GGAGTTTTGAGACACATTTCAATCAATGACTTACCAGTTGGCAGAAATTCTAAAGAAATT
TTAAGACTTGTCAAGGCTTTCCAATATACTGATGTGTATGGAGAAGTGTGCCCTGAATCC
TGGCAACCAGGCTCTGCCACCATGGTCCCAGACCATGAAAGTGAAAAACTCGGAGATTTC
TGGAAGAATCAGCATGGAAAAGCTACTTAA