Identifiers and Description

Gene Model Identifier

SteCoe_21202

Standard Name

None

Aliases

None

Description

Ribosomal_L26 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16644.0.g573.873997628687187e-21KOW motif

Saccharomyces CerevisiaeYLR344W1.0530617357553812e-20Ribosomal 60S subunit protein
L26A; binds to 5.8S rRNA; non-
essential even when paralog is
also deleted; deletion has mi
nimal affections on ribosome b
iosynthesis; homologous to mam
malian ribosomal protein L26 a
nd bacterial L24; RPL26A has a
paralog, RPL26B, that arose f
rom the whole genome duplicati
on
WormBaseWBGene000044407.781132241133797e-20
Tetrahymena ThermophilaTTHERM_003823505.74952226429356e-19Homolog of Yeast RPL26, Human
RPL26, Bacteria RPL24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21202(Protein)
MKQNKSVSSSRRKARKAYFTAPSSVRRKLMSAHLAKDLKEKHQVRSMPIRRGDEVIVVRG
QNKSHAGKVISVYRRRFCIHIERYTKEKSNGQTVPVPVHPSNVFITKLKMTEDRKNLIER
KAQNRKDKGKYSKKDIQSVD


>SteCoe_21202(CDS)
ATGAAACAGAACAAATCTGTAAGTAGCTCTCGAAGAAAAGCTAGAAAAGCATACTTCACA
GCTCCTTCCAGTGTTCGCAGAAAGCTCATGAGTGCTCATCTAGCTAAAGATCTCAAAGAA
AAACATCAAGTAAGATCCATGCCAATTCGAAGAGGTGATGAAGTTATAGTCGTCAGAGGC
CAAAACAAATCTCATGCAGGTAAAGTTATATCTGTCTATAGGCGTAGGTTCTGTATCCAC
ATTGAGAGGTACACAAAAGAAAAAAGCAACGGGCAAACAGTTCCAGTCCCAGTCCACCCA
AGCAATGTGTTCATAACAAAACTTAAAATGACTGAAGACCGAAAGAATCTCATAGAAAGA
AAAGCTCAGAATAGAAAAGATAAAGGAAAATACTCAAAGAAAGATATCCAATCAGTAGAC
TAA