Identifiers and Description

Gene Model Identifier

SteCoe_21486

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_0000869665.814040485895939e-62leishmanolysin family protein
Oxytricha TrifallaxContig18862.0.g774.359610000063081e-28hypothetical protein

WormBaseWBGene000002540.0024787521766663585

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21486(Protein)
MMILLIAYSTIQASANSETFESLGDIKIKVKTSDLDIKLYAYMDDIKNFEYLLMLSNRLA
EHSYSYDLYLLDMIFSCNSESFYSSLPEANFYIIINSANELSSPLTISKCQTSTMVAYTV
HLPYNNLDKLWGISQALIEENLSKVINPAIILMIGQPRKLQDTCGDFSYFSQGTGNCEMC
MVGCRECDNFLTCNTCYEGSEDSWSYYKLSSGACAVCYWWECLTCDTETTCSKCMPGYFL
SEDHMSCDKCSEHCSECVDNVQCAICNDGYFTDTSGKCQPCLGGCLHCISDTTCDQCYSG
FYLNETPVDTCELCMPNCKVCDSENCLTCSEGYFVENGMCSQCSFGCSGCTDRQTCQTCF
KEFYLNNDQDCELCTDNCVTCNGGNCETCSFGYFLNEFNKCSPCSQLCGECTDNENCLWC
KEGYLEGGLCVSCSQGCASCSPGDGCNFCDKHFFLYTNNLCYPCMEGCTDCSDSQTCTFC
NYDYYLENSICHYCGEGCTWCNEADICEICDIGFFIDYSHQPTVDCKKCHLNCNYCDANT
CYECIPGFEVDANGGCSPCGEGCSECNAIGCVNCFDGYYWDLSYSLCLGCNSNCNTCYNY
ETCSSCKEGMFLRDDGTCGHCPNYCSGCWDSNYCYHCYEGYYTNQQGWCKSCKYGCSVCS
ANGCFECYPGFFNNNGECKNCQSNCKSCNSKDACDACYDGFYWDGQYCMPCLNNCKICES
ASTCAKCLDTYYINKIDSCSKCQEGCIKCLTFETCEICDGGFLLQNTGICDSCKEGCAWC
TNVATCDLCKKGFYMDDLNNCIPCIAFCDSCNSYNCDYCADRFYLGIDINNKQACIECKE
NCQYCVEGYCYQCDQGFRLENGLCIPCSNNCDYCDSSGCNWCLRGYFLDDNNNCIPCSDH
CLHCDSLSYCYQCEDGYKYEYITNQCISCHDFCVSCDQDMKCFQCQERYFVDGNGDCQEC
SPSCKSCDANGCLICYNWMYLDDSHNCNYCSGGCSRCSDSKTCLECIPYTYLTTDDNVFY
YCKMCEIEGCEFCDENSCFWCEHGRYWDETDKICNYCPNNCDVCEDMNTCLKCSEKYYAD
ENGECWPCEPGCNYCVPYEFDDYGTLCESCTYNFFWQDYHCTPCPANCIYCYNESNCYYC
ENSYFLSNDDNQCYPCLANCQVCYNSYTCNNCYNGFYIDENYKCSSCMYGCVYCASSDYC
YWCEDDFWHNGHICIYCGEGCNYCEEEGKCGWCAGGYFIENPTPESAICSSCSSNCRHCY
SYEDCYECYPGFSVALGKCSTCQQGCFECNSAGCITCFEEFVLDENGECVPCTEFCDYCL
DDGTCLYCREGFFIKWISDTENICDYCGYFCLDCYDADYCFDCEQGYFASKYGKCEPCGY
ACASCSDNWCEKCYNGFYKDENGDCIDCIPHCNYCLSGNDCTSCEIGYFWDGNYCMPCSD
NCLQCESFEYCHSCNETYFINDINACSQCVEGCFSCKNLDACDECILGYYQNNLNGCSIC
SEGCQSCLDIQYCNYCFDGYYVNDGYCVKCIDNCQYCNAYGCYNCMQGFYFGMDNNNKIC
VRCNDNCLDCNSKNCYWCEVGYRFEGNNCIACSENCKFCDEISCYECKKGNTLDKNSLCI
PCIQNCNYCDYSGYCFECIDGYRYDYNAQLCTNCNDNCLVCDENLFCLECITGFYSDLDG
YCYPCQHGCTSCTANGCQICQDGMYLDYDSLACGWCSHRCMLCSSYKLCTKCWNYAYLVG
NLTDAFCEHCSIRRCIECDAQICYKCQDGWFLNITDNMCNSCTSNCFACNDSLICDICYD
GFYKDEYDQCISCEEGCNRCKVDDVDKTGTVCEECGYMFFYENNHCHPCSTGCGWCTSLE
ECSGCIIGYFYSQTTDGCEPCSPHCGYCENKLSCNDCESGYYLDEDLYCYQCSYRCLYCE
NYDFCYRCDSGFYEYYNNNNNITCLQCNEGCNDCASEDYCYHCELGYYMQNNTVTTECLP
CGQNCRYCYNSESCYECFNGFNLNGQVCSMCELGCYYFDSNNNCTRCMSNCAYCLEENIC
YSCEEGFYVEWISDTKSYCEFCGWDCKFCLDADYCTECYEGYFANNKGLCEQCPYGCAIC
NTQDCYECYAGFFKDLSGQCLKCIPNCAECLDGNLCVRCDLGYFWNGDFCMPCSDECLEC
SSPSQCHTCNDTFFVNDLNTCSKCIYGCLKCQDSMSCNQCDIGMFRNDDGLCERCMEGCS
YCNNLDFCDVCSYGYFLEYENWTCVGCIDYCEYCEHDYCYYCQERYYIEYTEFDEQVCTS
CEKNCLNCNATVCYYCESGYKVEGAFCEECPSNCDYCTDEDGCLWCKQGYYQDNSGYCRQ
CSKNCMYCGSESYCWQCNDGYRYDDYTNECTLCKDNCVLCDNDRKCLECDANFFPDPQGD
CAPCPWGCTSCTASECLQCDYGLYLNDRGECDWCSSMCSQCESYDVCVECYDSFYVYDLG
DGTSICRSCSQGCIRCDSETCSQCEYGKYLSSTGQCLSCMKNCNYCTDGETCNECSAGFY
LDSDSLCYSCDVGCNYCYLNPDDSTSTICISCGSGYYLDDEESICYSCSNNCLWCYNDDE
CQICEEYYYLSKSDNKCHACNTHCQYCTNRYSCDICDPGYFFNQINLGCVKCPENCDYCD
NLGCASCSYEYFLSDKGECVHCAPNCEYCTDIDYCYQCMKGFFTDWNTGHCKPCINNCYE
CGDENTCITCYSGFRVSSTGTQCIQCPQNCLFCSEIGCDTCFYGYFINESGNCQKCGEGC
AFCTDETQCFACDYYYHEDPDNFGECIECSDHCMYCDNNFCYYCDYGFFPHDNECSSCSY
GCIYCEDNTYCYECAAGFYLNEEDGVCEQCDMDNCLECSNGKTCDVCEEGYSLSSFGYCY
DCGANCIECDTSGYCMKCEDHYFVGEDGYCVACQEFCTTCMNFEFCYGCIEGFYQDSEGK
CQFCTLHCSQCDDFDNCNQCERGYYFASKKCNKCMENCEDCSAPSKCNVCSSGYYRDASD
VCQKCLDPNCDKCDANKCLACNDGFALNQTSKNCTACINGCSKCTNSKDCSNCFDGYYLT
QTKNADGSNSPSCPKCTSPCMTCTKPGYCRSCYEGFYMDNENCLSCSANCANCEDVNICN
FCFDGYYANSAGTCDKCQKNCAKCDGPDVCAKCSDGFYADETGQCLACTANCKVCLDQNT
CDECVDKYFLTYDRKCSLCSSNCKVCDENSICSECIYSFALVSNKCTRCTDPTVLKSSID
ASFTFITIEFLNKIDKPQFSCQLAFITESNLGQDWKCAAKGNQLIVTFGTGFLFTSTSAY
SINATELFVFPCNSLPDGYNAGYSKQPPTPSGKIKGPVQQSLSCDAKDLTYSADGLNGNL
NNALFVTWSAKITPNKQEVVDYIATLDKTSILVPLALFDVIDAELIMTMNVKNSFNKTSS
TSFTTKLSAQKSITVAIDAGTNATLVTSKKYVYTAKVKDACGAADRIVFTWALTATSCPL
DIANITAKILPPKVQNQLSIPENTLLPGYFYDFQATSTSGTLSGTATIRLTTEASPLAVK
IDKANGSVSGELDLVIDGSTSYDPNGLAKTIYFTWSCVYDDTGKICEDSNGSSLIQVWDQ
NVLTIPSASLVGGKSLKFTLTISNDYDKRTASTSVILKVIAGLSTNINISPPEGLVQPSY
SLEVMATITSKTTYSLKWTMLEGPEGIIIEHNYLQVFMFKANTLIAGYSYKFQLTATETG
SQNQATAEVEFKTNTAAVCYSPLAITPSTGIALIDTFKFSIDSCTDPDNEASTLTYTFGI
TTSNGVNYKMGIPKLFSDISVKIFEGELIGWVRVCDDYFGCSFYTANFEVYPYESRRLAE
STIINDYDALTEEPDNIPLYVVAFLKTFNLTSDELDYLHESIMDYLEEETINQDIIDILL
TVVLELLNMKQRPVLTYDRCALYLSELIEYMQNSTEEITEAHVAISLEIAKIVVTIGESA
IEYVELANQFVEEIMKLYSLKLLPGSEVYKEESDDMIYYKYKDTSANYENSTFEFSDGVS
VEIESLPFNASSIINLIITSYSSDAEYSNSIEITFTTSGTYENNVLTTSDEVITTLSTPT
VFLNFPILKNCTGDWACQYYDGSIWTEDGCTVIGEIDGKVKVQISHTSKFRIYDSELVSS
SDGSDDKNDGKHYGTVVIIGLLLLILCIGYTIGYLLDRNILKEKIVQAHVHHGSPVEEIC
ENKDISHGFEKVDSPNEKSDIEKKSSLDSTVVIYKPSILKYHLTLGIFYNDPTFPKHDRV
LSFILLLACQLTLEGALIGYYAIDEIYLSRSAAVAIIAVGLTLPLHATINLNLRAMLGRK
CFIPTIIGFIAFAVCIALTVAISVKLTVGRHSEWVISFFWGFLFEMAVQTIIMASRYFIE
SKFRN


>SteCoe_21486(CDS)
ATGATGATACTATTGATTGCTTATTCGACAATTCAAGCATCTGCGAATTCAGAGACCTTC
GAGTCTCTTGGTGATATAAAAATAAAGGTCAAAACTTCAGACCTCGATATAAAACTCTAT
GCTTACATGGATGATATTAAAAACTTTGAATACCTACTAATGTTATCCAACAGACTAGCT
GAGCATTCATATTCTTATGATTTATATCTTTTGGATATGATTTTTTCTTGTAACTCAGAA
AGCTTCTATTCATCCCTCCCTGAAGCTAACTTCTATATAATTATAAACTCAGCTAATGAA
CTATCTTCCCCTTTAACTATTTCTAAGTGCCAAACTTCTACAATGGTTGCCTATACAGTT
CATTTGCCATACAATAACCTCGATAAACTTTGGGGAATATCTCAAGCTCTTATTGAAGAA
AATCTATCCAAAGTCATAAACCCCGCAATAATTTTAATGATAGGCCAGCCAAGAAAGCTG
CAAGATACATGTGGGGACTTTAGTTATTTCAGTCAAGGTACTGGAAATTGTGAAATGTGC
ATGGTAGGATGCAGAGAATGTGATAATTTTCTAACATGTAATACCTGCTATGAAGGAAGT
GAAGATTCTTGGAGCTATTATAAACTTTCAAGTGGGGCTTGTGCTGTTTGCTATTGGTGG
GAATGTTTAACTTGCGACACAGAAACAACTTGTTCAAAATGTATGCCAGGCTATTTTCTT
AGTGAAGATCATATGAGTTGTGATAAATGTTCTGAGCATTGTAGTGAATGCGTAGATAAT
GTGCAATGTGCTATTTGTAATGATGGATATTTTACAGATACTTCAGGAAAATGCCAACCT
TGTCTTGGAGGATGTCTACATTGCATTTCAGATACAACTTGTGATCAATGCTATTCAGGA
TTTTACTTAAATGAAACCCCAGTTGATACATGCGAACTATGCATGCCAAATTGTAAAGTA
TGCGATAGTGAAAATTGTCTAACTTGCTCAGAAGGCTACTTTGTTGAAAATGGTATGTGT
TCCCAATGCAGTTTTGGATGCAGTGGATGTACTGATAGACAAACATGCCAAACATGCTTT
AAAGAATTTTATTTAAATAACGATCAAGACTGTGAATTATGTACTGACAACTGTGTTACT
TGCAACGGCGGTAACTGCGAAACTTGTTCATTTGGTTATTTTTTAAATGAATTTAATAAA
TGTTCACCTTGTTCTCAACTTTGTGGAGAATGCACTGATAATGAAAATTGTCTTTGGTGC
AAAGAAGGCTATTTAGAAGGTGGACTTTGTGTTAGCTGCTCACAAGGTTGTGCTAGTTGT
AGCCCAGGAGATGGATGTAATTTTTGTGATAAACACTTTTTCCTATACACTAACAACCTT
TGCTATCCTTGCATGGAGGGCTGTACAGATTGCTCTGATAGTCAAACCTGTACCTTTTGT
AACTATGACTACTACTTAGAAAATTCAATTTGTCATTATTGTGGAGAAGGGTGCACTTGG
TGTAATGAAGCAGATATATGTGAAATATGCGATATTGGGTTCTTCATAGATTATTCTCAT
CAGCCTACTGTAGACTGTAAAAAATGTCACTTAAATTGCAATTATTGTGATGCTAATACT
TGTTATGAATGCATTCCTGGATTTGAAGTTGATGCAAATGGTGGATGCTCTCCTTGTGGT
GAAGGGTGTAGTGAATGTAATGCAATTGGCTGTGTCAATTGCTTTGATGGATACTATTGG
GATTTAAGTTATTCATTATGCTTAGGATGCAATAGTAATTGCAATACGTGCTATAATTAT
GAAACATGTTCAAGTTGCAAAGAAGGAATGTTCCTTAGAGATGATGGAACTTGTGGACAT
TGCCCGAATTATTGCAGTGGATGCTGGGACTCTAATTATTGTTATCATTGCTATGAAGGG
TATTATACAAATCAACAAGGATGGTGTAAATCGTGTAAATATGGGTGTTCTGTCTGCAGT
GCTAATGGCTGCTTTGAATGCTATCCAGGATTCTTTAATAATAATGGAGAATGTAAAAAT
TGTCAGTCTAATTGCAAAAGCTGTAATAGCAAAGATGCTTGTGATGCTTGTTATGATGGG
TTTTACTGGGACGGGCAGTACTGTATGCCATGCTTAAATAATTGTAAAATCTGTGAATCT
GCTTCTACTTGTGCCAAATGCTTAGATACTTACTATATAAACAAAATAGATTCCTGTAGC
AAATGCCAAGAAGGATGCATAAAATGTTTAACCTTTGAAACCTGCGAAATTTGTGATGGT
GGATTTCTACTCCAAAATACCGGAATTTGTGATAGTTGCAAAGAAGGTTGTGCTTGGTGT
ACTAATGTAGCCACATGCGACTTATGCAAAAAAGGTTTCTATATGGATGATTTAAATAAC
TGTATACCCTGCATTGCATTCTGTGATAGTTGTAACTCCTATAATTGTGATTATTGTGCA
GATCGTTTTTATCTAGGAATTGATATTAATAATAAGCAAGCTTGCATAGAGTGTAAAGAA
AACTGTCAATACTGTGTTGAAGGATATTGCTATCAATGTGATCAAGGCTTTAGACTAGAA
AATGGTCTCTGTATCCCTTGCAGTAATAACTGTGATTATTGCGACAGCTCTGGATGCAAT
TGGTGCTTAAGAGGATACTTTTTAGATGACAATAATAACTGTATACCTTGTAGTGATCAC
TGCTTACATTGTGACTCATTATCTTATTGTTATCAATGTGAAGATGGTTATAAATATGAA
TACATTACAAATCAATGCATTTCATGTCATGACTTTTGTGTCAGTTGTGATCAAGATATG
AAGTGCTTTCAATGTCAAGAAAGATATTTTGTTGATGGTAATGGAGATTGCCAAGAATGT
TCCCCTAGCTGTAAGTCTTGTGATGCAAATGGATGCTTGATTTGTTATAATTGGATGTAT
TTAGATGATAGTCATAATTGTAATTATTGCTCTGGTGGATGCTCGAGATGCTCAGATTCT
AAAACTTGTTTAGAATGCATACCTTATACCTATTTGACTACAGATGATAATGTTTTTTAT
TATTGTAAGATGTGTGAGATAGAAGGGTGCGAATTTTGTGATGAAAATAGTTGCTTTTGG
TGTGAGCATGGAAGATACTGGGATGAAACAGATAAGATATGCAATTATTGTCCTAATAAT
TGTGATGTGTGTGAAGATATGAATACCTGCCTTAAGTGCTCAGAAAAGTATTATGCTGAT
GAAAATGGTGAGTGTTGGCCATGCGAGCCTGGATGCAATTATTGTGTGCCCTATGAATTT
GATGATTATGGAACACTATGTGAATCATGCACTTATAACTTCTTCTGGCAAGATTACCAT
TGTACTCCGTGTCCTGCTAATTGTATTTATTGCTATAATGAGTCTAATTGCTATTATTGT
GAGAATTCTTATTTCTTATCGAATGATGATAACCAGTGCTATCCTTGTCTTGCTAATTGT
CAAGTATGCTACAATTCATATACATGCAACAATTGCTATAACGGCTTTTACATTGATGAA
AATTATAAATGCTCTAGTTGTATGTACGGTTGTGTATATTGTGCTTCTTCTGATTATTGC
TACTGGTGTGAAGATGATTTTTGGCATAATGGACATATTTGTATTTACTGTGGGGAAGGC
TGCAATTACTGCGAGGAAGAAGGAAAATGTGGTTGGTGTGCAGGTGGATATTTTATTGAA
AATCCGACTCCAGAATCTGCAATATGCTCTAGCTGTAGTTCTAATTGCAGACACTGTTAC
AGCTACGAAGATTGCTATGAATGCTATCCAGGTTTTTCTGTAGCCTTAGGAAAATGCAGT
ACTTGCCAACAAGGTTGTTTTGAATGTAATTCAGCAGGTTGCATAACTTGCTTTGAAGAG
TTTGTCCTAGATGAAAATGGCGAATGTGTCCCATGCACAGAATTTTGTGATTACTGCTTA
GATGATGGAACTTGTCTATATTGTAGGGAAGGTTTTTTCATAAAGTGGATTTCTGATACA
GAAAACATATGCGATTATTGTGGATACTTTTGTTTGGATTGTTATGATGCTGATTATTGT
TTTGATTGTGAGCAAGGCTATTTTGCAAGCAAATATGGTAAATGCGAACCCTGTGGTTAT
GCATGCGCAAGCTGCAGCGACAACTGGTGTGAAAAATGCTACAATGGTTTTTACAAAGAT
GAAAATGGTGATTGCATCGATTGTATCCCACATTGCAATTATTGTCTAAGTGGTAATGAC
TGTACCAGCTGTGAAATTGGGTATTTCTGGGATGGGAATTATTGTATGCCTTGTTCTGAT
AACTGTCTTCAATGTGAATCCTTTGAATATTGCCATTCTTGTAACGAAACTTACTTTATC
AATGATATAAATGCTTGTAGTCAATGCGTAGAAGGATGCTTTTCTTGTAAGAATTTAGAT
GCTTGTGATGAATGCATTTTAGGATACTATCAGAATAATTTGAATGGATGTAGTATATGC
TCTGAAGGCTGTCAAAGTTGCTTGGATATACAATATTGCAACTATTGTTTTGATGGATAT
TACGTTAATGATGGATATTGTGTTAAGTGTATTGATAATTGCCAATACTGTAATGCTTAT
GGATGTTATAATTGCATGCAAGGATTTTATTTTGGAATGGATAATAACAATAAAATTTGT
GTACGATGCAATGATAATTGCTTGGATTGCAATTCAAAAAATTGCTATTGGTGTGAAGTC
GGATATAGATTTGAAGGTAATAATTGTATCGCATGCTCAGAAAATTGTAAATTTTGCGAT
GAAATTTCGTGCTATGAATGCAAAAAAGGGAACACTTTAGATAAAAATTCTCTTTGTATA
CCATGCATACAAAACTGCAATTATTGCGATTATAGTGGTTATTGCTTTGAATGCATTGAT
GGTTACAGATATGATTATAATGCTCAACTCTGCACAAATTGTAATGACAACTGCTTAGTA
TGTGATGAAAACCTATTTTGCCTTGAATGCATTACTGGATTCTACTCTGATCTTGATGGA
TATTGTTACCCTTGCCAACATGGTTGTACCTCTTGCACTGCTAATGGATGCCAAATTTGT
CAAGATGGGATGTATCTTGATTATGATAGCTTGGCTTGTGGCTGGTGCTCACATAGATGT
ATGCTTTGTTCAAGCTACAAACTATGTACAAAATGTTGGAATTACGCTTATTTAGTAGGA
AACTTAACTGATGCATTTTGTGAACATTGCTCTATCAGAAGATGCATAGAATGCGATGCT
CAAATTTGTTATAAATGCCAAGATGGGTGGTTTTTAAATATAACTGATAATATGTGCAAT
AGCTGTACTAGTAACTGTTTTGCATGTAATGATTCTTTAATATGTGATATATGTTATGAT
GGATTCTATAAAGATGAATATGATCAATGTATTTCTTGTGAAGAAGGATGCAATAGGTGC
AAAGTAGATGATGTAGATAAAACTGGAACTGTTTGTGAAGAGTGCGGCTATATGTTTTTC
TATGAAAACAATCATTGTCATCCATGCTCAACAGGATGTGGCTGGTGTACAAGTTTAGAA
GAATGCTCTGGATGTATTATTGGCTACTTTTACTCTCAGACTACTGATGGGTGTGAGCCT
TGTTCTCCTCATTGCGGATATTGTGAGAATAAACTTTCTTGCAACGATTGCGAATCCGGT
TATTATCTAGATGAAGACTTATACTGTTATCAATGTAGCTATAGATGCTTATATTGTGAA
AATTATGATTTTTGCTATAGGTGTGATAGCGGTTTCTATGAATATTATAACAATAACAAC
AATATTACATGTTTACAATGCAATGAAGGTTGCAATGATTGTGCGTCTGAAGACTATTGT
TATCATTGTGAATTAGGATACTATATGCAAAATAATACAGTCACTACTGAATGCTTACCC
TGTGGGCAAAATTGTAGGTACTGCTACAATTCTGAATCATGCTATGAATGTTTTAATGGC
TTCAACTTGAATGGCCAAGTTTGCAGCATGTGTGAACTAGGATGCTACTATTTTGATAGC
AATAATAATTGTACAAGATGCATGTCTAATTGCGCTTATTGCTTAGAAGAAAACATATGT
TATTCTTGTGAAGAAGGCTTTTATGTAGAATGGATTAGTGATACTAAGAGTTATTGCGAA
TTTTGTGGCTGGGATTGTAAATTTTGTCTTGATGCTGATTATTGTACTGAATGCTATGAA
GGATATTTTGCAAATAATAAAGGATTATGTGAGCAATGCCCATATGGATGTGCGATTTGT
AATACTCAAGATTGCTATGAATGCTATGCTGGGTTTTTCAAAGATTTATCAGGCCAATGC
TTAAAGTGTATACCTAATTGTGCAGAATGCTTAGATGGGAATCTTTGTGTTCGTTGTGAT
CTTGGGTATTTCTGGAATGGAGATTTTTGTATGCCATGCAGTGATGAATGTTTGGAATGT
AGTTCGCCAAGTCAGTGCCATACATGTAATGACACATTTTTTGTTAATGATTTAAATACA
TGCAGTAAATGCATTTATGGATGTTTGAAATGTCAAGATTCAATGAGCTGTAATCAATGT
GATATTGGAATGTTTAGAAATGATGATGGACTTTGTGAAAGGTGTATGGAAGGATGCTCT
TATTGTAATAATTTAGACTTTTGTGATGTATGTAGCTATGGATACTTCCTTGAATATGAA
AATTGGACTTGTGTTGGATGCATTGATTATTGTGAATACTGTGAGCATGATTATTGTTAT
TATTGTCAAGAAAGATATTATATAGAATATACAGAATTTGATGAACAAGTATGCACTTCT
TGTGAAAAGAATTGTTTGAATTGCAATGCAACTGTATGCTATTATTGTGAAAGTGGATAT
AAAGTTGAAGGGGCATTTTGTGAAGAATGTCCTTCTAATTGTGATTATTGCACTGATGAA
GATGGATGCTTATGGTGTAAACAAGGATATTATCAGGATAATAGTGGGTATTGTAGACAG
TGTAGTAAAAATTGTATGTATTGCGGTTCAGAAAGCTACTGTTGGCAATGCAATGATGGA
TATAGATATGATGATTATACAAATGAATGCACCTTATGTAAAGATAATTGTGTGCTTTGT
GATAATGATAGAAAATGTTTAGAATGTGATGCGAATTTCTTCCCAGATCCTCAAGGGGAC
TGTGCTCCATGCCCATGGGGTTGTACATCATGTACAGCTTCTGAATGCTTACAATGTGAT
TATGGTCTATATCTCAATGATAGAGGTGAATGTGATTGGTGCAGCTCAATGTGTTCTCAA
TGCGAAAGCTACGATGTTTGTGTTGAATGCTATGATTCCTTCTATGTCTATGATCTTGGA
GATGGGACATCAATCTGCAGATCATGCAGCCAAGGGTGTATAAGATGTGATAGTGAAACA
TGCTCACAATGCGAATATGGTAAATATTTATCATCAACTGGCCAATGCCTTTCCTGTATG
AAAAACTGTAACTATTGTACAGATGGTGAAACTTGTAATGAATGCTCAGCTGGTTTCTAC
CTTGACTCAGATAGTTTATGTTATTCATGTGATGTAGGATGCAATTATTGTTATTTAAAC
CCAGATGATAGTACATCAACTATATGTATATCATGTGGCTCAGGCTATTATCTTGATGAT
GAAGAAAGCATATGTTATAGTTGTTCAAATAATTGCTTATGGTGTTATAATGATGATGAA
TGCCAAATATGTGAAGAATACTATTATTTATCAAAGTCTGATAATAAATGCCATGCTTGT
AATACTCATTGTCAATATTGTACTAATAGGTATTCTTGTGATATTTGTGACCCTGGGTAT
TTTTTTAATCAAATTAATCTTGGATGTGTCAAATGTCCTGAAAACTGCGATTATTGTGAT
AATTTAGGATGTGCATCTTGCTCATATGAATATTTCCTTTCTGATAAAGGAGAATGCGTT
CATTGTGCTCCTAATTGCGAATATTGTACTGATATTGATTACTGTTATCAATGTATGAAA
GGGTTTTTCACTGATTGGAATACCGGACATTGTAAACCTTGTATTAATAACTGTTATGAA
TGTGGTGATGAAAACACTTGTATAACTTGCTATTCTGGCTTTAGGGTATCATCTACTGGT
ACTCAATGCATACAATGCCCTCAAAATTGTTTGTTTTGCTCAGAGATTGGATGTGATACT
TGCTTTTATGGGTATTTCATCAATGAATCAGGAAACTGTCAAAAGTGTGGTGAAGGATGT
GCATTTTGTACTGATGAAACTCAATGCTTTGCTTGTGATTATTATTATCATGAAGACCCT
GATAATTTTGGAGAATGTATTGAATGTAGTGATCATTGTATGTATTGTGATAATAATTTC
TGTTATTATTGTGATTATGGATTTTTCCCTCATGATAATGAATGCTCAAGTTGCTCATAC
GGATGTATTTATTGTGAAGATAATACTTATTGCTATGAATGTGCAGCAGGATTTTATTTG
AATGAAGAAGATGGAGTATGCGAACAATGTGATATGGATAATTGTCTGGAATGCTCTAAT
GGAAAAACTTGTGATGTCTGTGAAGAAGGATACTCTTTAAGTAGCTTTGGGTATTGTTAT
GATTGTGGAGCTAATTGTATTGAATGCGACACTTCAGGATATTGTATGAAATGTGAGGAT
CATTACTTTGTTGGTGAAGATGGATACTGTGTTGCATGTCAAGAATTCTGTACAACATGT
ATGAACTTTGAATTTTGTTATGGATGTATTGAAGGTTTCTATCAAGATAGCGAAGGCAAA
TGCCAATTCTGTACACTTCATTGCTCTCAATGTGATGACTTTGATAATTGTAACCAATGT
GAAAGGGGTTATTATTTTGCAAGTAAAAAGTGTAATAAGTGCATGGAAAATTGTGAAGAT
TGTTCAGCACCATCAAAATGCAATGTCTGCTCTTCAGGCTACTATAGAGATGCAAGTGAT
GTTTGCCAAAAATGCTTAGATCCAAACTGTGATAAATGCGATGCGAATAAATGCTTAGCA
TGCAATGATGGCTTTGCACTTAACCAAACATCTAAGAACTGTACAGCTTGTATAAATGGG
TGTAGCAAATGTACAAATAGTAAAGACTGCTCAAATTGTTTTGATGGATATTATTTAACA
CAAACTAAAAATGCAGATGGTTCTAATTCACCTTCATGTCCTAAATGCACATCACCATGT
ATGACTTGTACTAAGCCAGGATATTGTAGATCATGCTATGAAGGATTTTATATGGATAAT
GAGAATTGTCTTTCATGCTCAGCTAACTGTGCTAATTGTGAAGATGTGAACATTTGCAAT
TTCTGTTTTGATGGGTATTATGCTAATAGTGCTGGAACTTGTGATAAATGTCAGAAGAAT
TGTGCTAAATGTGATGGACCTGATGTATGTGCTAAGTGTTCTGATGGATTTTATGCTGAT
GAAACAGGGCAATGCTTAGCTTGTACAGCTAATTGCAAAGTATGTCTTGATCAAAATACT
TGTGACGAATGTGTTGATAAATATTTCTTGACTTATGATAGAAAATGCTCATTATGCTCA
TCGAATTGTAAAGTCTGTGATGAAAATTCTATATGCTCTGAGTGCATCTATAGTTTTGCT
TTAGTTAGCAATAAATGTACTAGATGCACAGATCCGACTGTATTAAAATCTTCGATTGAT
GCTTCTTTCACTTTTATTACTATTGAGTTCTTAAACAAAATAGATAAACCTCAGTTCAGT
TGCCAATTAGCTTTTATAACTGAAAGTAATTTAGGCCAAGATTGGAAATGTGCAGCTAAA
GGCAATCAACTTATTGTCACATTTGGAACTGGATTTTTATTCACATCAACTTCTGCTTAC
AGCATTAATGCTACTGAACTTTTTGTATTCCCTTGTAATTCTCTTCCAGATGGTTATAAT
GCTGGATATTCTAAACAGCCACCTACACCTTCTGGTAAAATCAAAGGTCCTGTACAACAG
TCTTTATCTTGTGATGCTAAAGACCTTACTTATTCAGCTGATGGACTTAATGGAAATCTG
AACAACGCTTTGTTTGTAACTTGGAGTGCTAAGATTACCCCTAATAAACAAGAAGTTGTT
GACTATATTGCAACTTTAGATAAAACAAGCATTCTTGTCCCACTGGCTTTATTCGATGTA
ATCGATGCTGAATTGATTATGACTATGAATGTTAAAAATAGCTTTAACAAGACTAGCAGT
ACAAGTTTTACAACTAAACTATCTGCACAAAAGTCTATTACTGTAGCTATTGATGCAGGA
ACTAATGCAACACTTGTTACCTCTAAGAAATATGTGTATACAGCTAAAGTTAAAGATGCT
TGTGGCGCTGCAGACAGAATTGTATTTACATGGGCTTTAACTGCAACAAGCTGTCCTCTA
GATATTGCAAATATCACTGCTAAAATACTACCTCCAAAAGTTCAAAACCAACTGTCAATA
CCAGAAAACACTCTTCTTCCTGGGTATTTCTATGATTTCCAAGCCACTTCTACATCTGGA
ACCTTATCAGGTACTGCAACAATAAGACTTACAACAGAAGCATCACCTCTTGCTGTCAAA
ATCGATAAAGCTAATGGATCAGTATCAGGTGAACTTGATTTAGTTATAGACGGAAGTACT
TCATATGACCCTAATGGACTTGCTAAAACTATTTATTTCACTTGGTCATGTGTATATGAT
GATACAGGCAAAATCTGTGAAGACTCTAATGGCAGTTCTTTAATACAGGTTTGGGACCAA
AATGTTCTTACGATCCCATCAGCAAGTTTAGTAGGAGGAAAATCTCTTAAATTTACTTTA
ACAATATCAAATGACTATGATAAACGAACAGCATCAACTAGTGTTATACTTAAAGTTATT
GCAGGGCTTAGTACAAACATAAATATTTCACCGCCTGAAGGACTTGTTCAGCCTAGTTAC
AGCTTAGAAGTTATGGCTACAATAACATCAAAAACTACTTATAGCCTGAAATGGACAATG
CTTGAAGGGCCTGAAGGTATTATAATTGAGCATAATTACCTCCAAGTTTTTATGTTTAAA
GCTAATACTCTCATTGCTGGCTATAGCTATAAATTCCAACTTACAGCTACTGAAACTGGT
TCACAAAATCAAGCTACTGCAGAAGTTGAATTCAAAACAAATACTGCTGCAGTTTGCTAT
AGCCCACTTGCAATTACCCCATCCACTGGTATTGCATTAATTGACACTTTTAAGTTTTCT
ATTGATTCTTGTACTGATCCTGATAATGAAGCAAGTACTTTAACATATACTTTTGGTATA
ACAACAAGTAATGGTGTTAACTATAAGATGGGTATTCCGAAATTGTTTAGTGATATTTCA
GTTAAAATATTTGAAGGCGAATTAATTGGATGGGTTAGAGTTTGTGATGATTACTTTGGA
TGCTCTTTTTATACAGCTAATTTTGAAGTCTATCCTTATGAAAGCCGTCGTCTTGCTGAG
TCTACTATTATAAATGATTATGATGCTTTGACAGAAGAACCTGATAATATTCCTCTTTAT
GTTGTAGCTTTCTTAAAGACATTTAACCTTACATCAGATGAATTAGATTATTTACATGAA
AGTATTATGGATTATCTTGAAGAAGAAACTATTAACCAAGATATTATTGATATTTTACTT
ACTGTAGTATTAGAATTATTGAATATGAAGCAAAGGCCAGTACTTACTTATGACAGATGT
GCACTTTATCTATCAGAGCTTATTGAATACATGCAAAACTCAACTGAAGAAATCACTGAA
GCACATGTTGCAATTTCTCTTGAAATCGCTAAAATTGTTGTTACTATTGGAGAATCAGCT
ATCGAATATGTAGAATTAGCTAATCAATTCGTTGAAGAAATTATGAAACTATACTCATTA
AAACTACTTCCTGGTAGTGAAGTATATAAAGAAGAATCAGATGATATGATTTACTATAAA
TACAAAGATACATCAGCTAATTATGAAAATAGCACATTTGAATTCAGTGATGGAGTGTCT
GTAGAGATTGAAAGCTTACCATTTAATGCATCTTCTATAATCAATTTAATAATTACAAGC
TATTCCTCTGATGCTGAGTATTCAAATAGTATTGAAATAACCTTTACAACTAGTGGAACT
TATGAGAATAATGTTTTAACAACAAGTGATGAAGTAATTACAACACTATCAACACCTACA
GTTTTTCTGAATTTCCCAATTTTGAAGAATTGTACTGGAGATTGGGCTTGTCAATATTAT
GATGGTAGCATTTGGACCGAAGATGGCTGCACAGTTATTGGAGAAATAGATGGAAAAGTT
AAAGTACAAATTTCTCATACATCTAAATTTAGGATTTATGACTCAGAACTTGTAAGTTCA
AGTGATGGAAGTGATGATAAAAATGATGGCAAACATTATGGCACAGTTGTTATAATTGGT
TTACTTTTGCTTATCCTTTGTATTGGCTATACCATTGGATATCTTCTCGACAGAAATATT
CTTAAAGAAAAAATCGTTCAAGCTCATGTCCACCACGGATCGCCTGTTGAAGAAATCTGT
GAAAATAAAGATATTTCTCATGGCTTTGAAAAAGTAGATAGCCCCAATGAAAAATCTGAT
ATTGAAAAGAAAAGCTCACTAGATTCAACTGTCGTAATCTATAAGCCATCTATACTCAAA
TACCATCTTACACTTGGCATTTTCTATAATGATCCAACATTCCCTAAACATGACAGAGTG
CTTTCATTTATTTTACTACTTGCTTGCCAATTAACATTAGAAGGAGCTTTAATTGGCTAT
TATGCAATTGATGAAATTTACTTATCAAGAAGTGCTGCTGTAGCTATTATCGCAGTTGGA
CTAACATTACCACTTCACGCTACTATCAACTTAAACTTAAGGGCTATGCTTGGGAGAAAA
TGTTTCATACCAACTATTATAGGCTTTATTGCTTTTGCTGTTTGCATAGCTCTTACTGTA
GCTATATCTGTAAAACTTACTGTTGGAAGACATTCTGAGTGGGTTATTAGTTTCTTCTGG
GGATTTTTATTTGAGATGGCTGTTCAGACAATTATTATGGCTTCCAGATACTTTATAGAA
AGCAAATTTAGGAATTAG