Identifiers and Description

Gene Model Identifier

SteCoe_21773

Standard Name

None

Aliases

None

Description

tRNA-synt_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig2447.0.g210tRNA synthetases class I (I, L
, M and V)

WormBaseWBGene000069360

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21773(Protein)
MSEEMKNALRQASKIAKDLTSPMAAAYDYQAVESEWGEWWESQGYFTPSAEKTIPLTPDQ
KFVMMIPPPNVTGSLHLGHALTGSIEDTLTRWNRMSGKSTLWLPGVDHAGIATQAVVEKQ
LAKQEGLSRHDLGREAFVDRIWQWKETYGNRICQQYKRVGISADWTRSCFTLDPKLNRAV
TEAFVRMFDMGIIYRANRLVNWSCFLKTAISDIEVEYKELNDITRIRVPNHKGTYEFGVL
HHFAYQVADSDEKIVVATTRLETMLGDVAVAVHPEDPRYKHLIGKKLIHPFLPERNMTVI
ADPVLVDMSFGTGAVKVTPAHDYNDFKCGERNGLEKISIFTEDGKINDNGGKFAGMMRFD
CRWAIEKELTAMGLWLSKEKNPMSLGFCSRSGDVIEPYLKPQWWVKCDNLAKRACSAVRE
GHLTILPDIYVDNWFHWLDNIQDWCISRQLWWGHRIPAYRVAVLSESGEKINTEQWVVGR
NYDEALQNAQKYKQNDTDSITISQDEDVLDTWFSSGLFPFSTLGWPDLESEDFKAFFPGT
ILETGHDILFFWVARMVMMSLCLTDQLPFTTVYLHAMIRDSDGKKMSKSEGNVIDPLEVI
NGCSLDVLIQKLKDSNLSEKAINTGIEGKKKEFPDGIPSCGSDAMRLGLLSYTIQGRNIN
LDIKRVVGYRLFMNKLWNIFKFATSTFPENFVPDPEFLNKRPNEFINRWIIHRMNKTIEN
VVQKLQKYEFGMTVQVLHEYWLHEVADTYLEAIKPVIRCADEASKISTANAMFHAIEKGL
LLMHPMIPFITEELYQRLPETPWKSISISIAPYPKYQAHLEDEESEIRMENIEKATHSIR
SMQANLNLFGKKPIIFIRCPDNVRALIEDQCEVIQILGKCGKVEIVNEVPKGCLMNINGN
IEVYLQIAGMVNVQAEITKLEKRKVQLVKTIEGTLKKMQTPNYEEKTPENVKETFRQKLK
DSEEELEKINMEVEKLKSAL


>SteCoe_21773(CDS)
ATGTCTGAGGAAATGAAAAATGCTTTAAGACAAGCTTCCAAGATCGCAAAAGATCTAACT
TCTCCTATGGCCGCCGCATATGACTACCAAGCTGTAGAGTCTGAATGGGGCGAATGGTGG
GAAAGTCAAGGATATTTCACTCCTTCAGCTGAGAAAACAATCCCATTAACTCCTGACCAG
AAATTCGTCATGATGATTCCACCACCTAATGTTACTGGATCTTTACATTTAGGTCATGCT
TTAACTGGATCTATTGAAGATACCCTAACTCGTTGGAATCGTATGAGTGGTAAATCAACA
TTATGGCTTCCAGGAGTAGATCATGCTGGTATTGCTACACAAGCTGTAGTAGAAAAACAA
TTAGCTAAACAAGAAGGGCTTAGTAGACATGATTTAGGTCGTGAAGCTTTTGTTGATAGG
ATTTGGCAATGGAAAGAGACTTATGGCAATCGTATATGTCAGCAATATAAAAGAGTTGGT
ATTAGTGCTGATTGGACTCGAAGCTGTTTTACTTTAGATCCAAAGCTTAATCGTGCTGTA
ACAGAAGCTTTTGTTAGAATGTTTGATATGGGGATTATATATAGAGCTAATAGACTGGTT
AATTGGAGTTGTTTTCTTAAGACAGCGATTAGTGATATTGAAGTTGAGTATAAAGAGCTT
AATGATATTACGAGAATTAGGGTTCCTAATCATAAAGGAACTTATGAGTTTGGAGTACTT
CATCATTTTGCTTATCAAGTTGCTGATTCTGATGAAAAAATAGTTGTTGCGACTACACGT
TTAGAGACTATGCTTGGTGATGTAGCTGTTGCGGTTCATCCTGAAGATCCTAGGTATAAA
CATCTTATTGGTAAAAAACTTATACATCCATTTTTACCTGAGAGGAACATGACGGTTATT
GCTGATCCAGTTCTTGTTGATATGAGTTTCGGTACAGGAGCTGTAAAAGTTACCCCAGCT
CATGATTATAACGACTTTAAATGTGGTGAAAGGAATGGGTTAGAAAAAATAAGCATTTTT
ACTGAAGATGGGAAAATAAACGATAATGGGGGCAAATTCGCTGGAATGATGCGATTTGAC
TGTAGATGGGCAATAGAAAAAGAACTTACAGCCATGGGTCTTTGGTTAAGTAAAGAGAAA
AACCCAATGTCTCTAGGTTTTTGTAGTAGAAGCGGTGATGTTATTGAACCTTATCTAAAA
CCTCAATGGTGGGTAAAATGTGACAACCTAGCCAAAAGAGCCTGTTCAGCAGTGCGTGAA
GGTCATTTAACAATTTTACCTGATATATATGTTGATAACTGGTTCCATTGGCTTGATAAT
ATCCAAGATTGGTGTATATCCCGACAGCTCTGGTGGGGTCATCGCATTCCAGCATACAGA
GTTGCAGTATTATCAGAATCAGGAGAAAAAATCAATACTGAACAATGGGTTGTTGGAAGA
AACTATGACGAAGCCTTACAAAATGCTCAAAAATACAAACAAAACGATACTGACAGTATA
ACAATTTCTCAAGATGAAGATGTACTAGATACTTGGTTTTCATCAGGATTATTCCCTTTC
TCAACTTTAGGTTGGCCAGATCTTGAAAGTGAAGATTTTAAAGCTTTTTTCCCAGGGACT
ATCCTTGAGACAGGCCATGATATATTGTTTTTCTGGGTTGCTAGAATGGTTATGATGAGT
TTATGTTTAACAGATCAGCTTCCTTTTACTACTGTGTATTTACATGCTATGATTCGTGAT
AGTGATGGGAAAAAAATGTCTAAATCTGAAGGAAATGTTATAGACCCACTTGAGGTTATT
AATGGATGTAGTTTAGATGTATTGATTCAGAAACTTAAAGATAGTAATTTGAGTGAAAAA
GCTATAAATACAGGGATTGAAGGGAAAAAGAAAGAGTTCCCTGATGGAATACCTTCTTGT
GGTAGTGATGCTATGAGGCTTGGATTGTTATCATATACAATACAAGGAAGGAATATTAAT
TTAGATATCAAAAGAGTTGTCGGGTATAGGCTTTTTATGAATAAACTGTGGAATATTTTC
AAGTTCGCAACAAGTACATTCCCTGAAAACTTCGTCCCAGACCCTGAGTTTTTGAATAAA
AGGCCTAACGAGTTTATTAATAGGTGGATTATTCACAGGATGAATAAAACTATAGAAAAC
GTTGTCCAGAAACTCCAGAAATACGAGTTTGGTATGACAGTTCAAGTACTTCATGAATAT
TGGCTACATGAAGTTGCGGATACATATCTTGAAGCTATTAAACCAGTTATCCGTTGTGCT
GATGAAGCATCAAAAATTAGCACAGCTAATGCTATGTTCCATGCTATAGAAAAAGGACTT
TTACTTATGCACCCTATGATTCCATTTATAACTGAAGAATTATATCAAAGACTTCCAGAA
ACTCCTTGGAAATCTATAAGTATCTCAATTGCCCCATATCCAAAATATCAAGCACATTTA
GAAGATGAGGAAAGCGAAATTAGAATGGAAAACATAGAAAAAGCTACACATAGTATAAGG
TCAATGCAAGCCAATTTAAATCTTTTCGGTAAAAAACCTATAATTTTTATAAGGTGTCCT
GACAATGTTAGAGCATTAATTGAAGATCAATGCGAAGTTATTCAGATTCTAGGTAAATGT
GGCAAGGTTGAGATTGTGAATGAAGTTCCTAAAGGGTGTCTTATGAATATCAATGGAAAT
ATTGAAGTTTATTTACAAATTGCCGGGATGGTCAACGTTCAAGCTGAGATCACAAAACTG
GAAAAACGTAAGGTTCAGTTGGTAAAGACCATAGAAGGAACGTTGAAAAAAATGCAGACA
CCAAATTATGAGGAAAAGACCCCTGAAAATGTTAAGGAAACCTTTAGACAAAAACTAAAA
GATAGTGAAGAGGAACTTGAAAAAATCAATATGGAGGTCGAGAAACTGAAATCAGCTCTT
TAA