Identifiers and Description

Gene Model Identifier

SteCoe_21805

Standard Name

None

Aliases

None

Description

MT-A70 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17486.0.g1008.854771883513433e-70MT-A70

Tetrahymena ThermophilaTTHERM_003884901.2806276389220833e-57MT-A70 family protein
Saccharomyces CerevisiaeYGL192W0.00000000000009357622968840175mRNA N6-adenosine methyltransf
erase required for entry into
meiosis; mediates N6-adenosine
methylation of bulk mRNA duri
ng the induction of sporulatio
n which includes the meiotic r
egulators IME1, IME2 and IME4
itself; repressed in haploids
via production of antisense IM
E4 transcripts; transcribed in
diploid cells where antisense
transcription is repressed; o
rthologous to human METTL3 (MT
-A70)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21805(Protein)
MKEIKKPKKPKKTKKRGVDINDKSKWGHRFEIRNRTKVVRDFFIEKPLPKKRPKTEDADT
DKDKQKFPKIKKAYSEPKPTKRRKVKDIEPEVIISEILEEILENILGDGLETKLEENEYI
NCDLRYFNLDYIVERHGFFDVIAIDPPWRIKGGQKNSDSPFMFSNNKFQLEYDTLSNQEI
MDIPIEKLSRKGFCFLWVLSGNMQAGYECLNKWGYECVDHLIWIKTSKGGSRAMISHGFY
FLHSTETCLVGYKCLPGEKLELISRISNDLIISDVRKKSQKPDQLYEIIDMMMPNSRKIE
VFARNNNLRKGWFSLGNQIGEVFEKWKNHMMCDKCKNEIPEGKVRYKSRKIRNFDICDKC
IDNVFTDRGDTQLDYFRLENKSQQNVLHHYHKCDRCGVEPIWATRFQCLQCENIDYCENC
YDEIIESKTGCYSHIFQAVEIPQAGNGLPVHENKRCVFCYQKPILGPCFLCANCNNFVLC
QTCFFSGNSKGIEKIKGHEPKHKIEMITLANVGMKVSTCFNCGASPLIARKHKCNHCFSY
ELCEGCFNKRDNPDFKASDTHLKTHTFNFIV


>SteCoe_21805(CDS)
ATGAAGGAAATAAAAAAGCCCAAAAAGCCAAAAAAAACAAAAAAGCGAGGAGTAGACATA
AATGACAAAAGCAAATGGGGACACAGATTCGAAATAAGAAACAGGACAAAAGTTGTTAGA
GACTTTTTCATCGAAAAACCCCTACCAAAAAAAAGACCGAAAACTGAAGATGCGGACACG
GATAAAGACAAACAAAAGTTCCCCAAAATTAAAAAAGCATATTCTGAACCTAAGCCAACT
AAAAGACGAAAGGTCAAAGATATAGAACCTGAAGTAATTATCAGCGAGATCTTAGAGGAA
ATCCTTGAAAACATCCTTGGCGACGGTCTAGAAACAAAATTAGAAGAAAACGAGTATATA
AACTGTGACTTAAGATATTTTAACCTAGACTACATCGTTGAAAGGCATGGTTTTTTCGAT
GTTATTGCAATTGATCCTCCATGGCGGATCAAAGGGGGCCAGAAAAACTCAGATTCCCCT
TTTATGTTTTCCAACAATAAATTCCAACTTGAATATGATACTTTATCAAATCAAGAAATC
ATGGATATTCCTATAGAAAAACTTTCTCGTAAAGGTTTTTGTTTCTTATGGGTACTCAGT
GGAAATATGCAAGCCGGCTATGAATGTTTAAATAAATGGGGTTATGAATGTGTTGATCAT
TTAATATGGATTAAAACATCTAAAGGAGGCTCAAGGGCAATGATCTCACATGGATTCTAT
TTCCTCCATTCAACAGAAACTTGTCTTGTTGGATACAAATGCCTTCCAGGTGAAAAACTT
GAACTCATATCGAGAATTTCAAATGATCTTATAATATCAGATGTACGTAAAAAATCCCAA
AAGCCTGATCAATTATATGAGATTATTGATATGATGATGCCAAACTCAAGAAAAATCGAA
GTTTTTGCTAGGAATAACAACTTAAGAAAAGGCTGGTTTTCATTAGGTAACCAAATAGGC
GAAGTTTTTGAGAAATGGAAAAACCATATGATGTGTGATAAATGCAAAAATGAAATCCCA
GAAGGCAAAGTTCGTTATAAGTCTAGAAAAATTAGGAATTTCGATATATGTGACAAGTGT
ATTGATAATGTTTTTACTGATCGTGGAGATACACAATTAGATTATTTTAGATTAGAAAAC
AAAAGCCAACAAAATGTTTTACATCATTACCATAAATGTGATAGATGTGGTGTTGAACCT
ATTTGGGCTACAAGGTTTCAATGTTTACAATGTGAAAATATTGATTATTGCGAAAATTGT
TATGATGAAATTATTGAATCTAAAACCGGATGTTATAGTCATATTTTCCAAGCTGTAGAA
ATCCCTCAAGCAGGAAATGGTTTGCCTGTACATGAAAATAAAAGGTGTGTATTTTGTTAT
CAGAAACCAATTCTTGGTCCTTGTTTTTTATGTGCTAATTGCAATAATTTTGTGTTGTGT
CAAACATGTTTTTTTAGTGGTAATTCTAAAGGTATTGAAAAGATTAAAGGTCATGAACCT
AAACATAAAATAGAAATGATTACTTTGGCTAATGTTGGAATGAAGGTATCAACTTGTTTT
AATTGTGGAGCTTCTCCACTTATTGCTAGAAAACATAAATGCAATCATTGTTTTAGTTAT
GAACTTTGTGAAGGGTGTTTTAATAAAAGAGATAATCCTGATTTTAAAGCTTCTGATACA
CATTTGAAAACTCATACTTTTAATTTTATAGTTTAG